diff --git a/BotLibre/README.md b/BotLibre/README.md
index 107d7c0822d9850c6ec7b8456ec056fb2c202129..eef39d62e9a7a7b7a32201e291e70b0563231f1c 100644
--- a/BotLibre/README.md
+++ b/BotLibre/README.md
@@ -5,10 +5,10 @@
 - 项目名称：BotLibre
 - 所属系列：OpenHarmony的第三方组件适配移植
 - 功能：人工智能、nlp、聊天机器人、虚拟代理、社交媒体自动化和实时聊天自动化的开源平台
-- 基线版本：master
 - 项目移植状态：主功能完成
 - 调用差异：无
 - 开发版本：sdk6，DevEco Studio2.2 Beta1
+- 基线版本：master
 
 ## 效果演示
 
@@ -23,7 +23,7 @@ Demo中调用library组件，然后通过五个功能操作展示组件。
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/BotLibre/build.gradle b/BotLibre/build.gradle
index a4bbee50c84428507c792bf978676f0ff6fe17a8..5e14ced4932a910a9064c5d2a471dafeb88e9285 100644
--- a/BotLibre/build.gradle
+++ b/BotLibre/build.gradle
@@ -2,6 +2,17 @@
 apply plugin: 'com.huawei.ohos.app'
 
 ohos {
+    signingConfigs {
+        debug {
+            storeFile file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_890086000102149657.p12')
+            storePassword '00000018FFA5B0DB00CC2DFB0A89B137185B03D94C95D55C2F0148EC9FCED9F4A791FF9785DC1833'
+            keyAlias = 'debugKey'
+            keyPassword '00000018D501A8D4DB4D6582A8035A2E4252EF3EC44C534D576759AC04E7BCBBF3E3A5A8070C2E7E'
+            signAlg = 'SHA256withECDSA'
+            profile file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_sdk_890086000102149657.p7b')
+            certpath file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_890086000102149657.cer')
+        }
+    }
     compileSdkVersion 6
     defaultConfig {
         compatibleSdkVersion 5
diff --git a/BotLibre/entry/src/main/config.json b/BotLibre/entry/src/main/config.json
index 59f4add68531d23c6a9c39c5d4b8176cf66f999f..73625b375b260708b7108ab1a1e24134225f04f6 100644
--- a/BotLibre/entry/src/main/config.json
+++ b/BotLibre/entry/src/main/config.json
@@ -40,58 +40,58 @@
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.avatar.AvatarSelection",
+        "name": "org.botlibre.sdk.ability.avatar.AvatarSelection",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.LoginAbility",
+        "name": "org.botlibre.sdk.ability.LoginAbility",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.CreateUserAbility",
+        "name": "org.botlibre.sdk.ability.CreateUserAbility",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.ChatAbility",
+        "name": "org.botlibre.sdk.ability.ChatAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.war.StartWarAbility",
+        "name": "org.botlibre.sdk.ability.war.StartWarAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.LibreAbility",
+        "name": "org.botlibre.sdk.ability.LibreAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.BotSearchAbility",
+        "name": "org.botlibre.sdk.ability.BotSearchAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.SearchAbility",
+        "name": "org.botlibre.sdk.ability.SearchAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.HelpAbility",
+        "name": "org.botlibre.sdk.ability.HelpAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.ListTagAbility",
+        "name": "org.botlibre.sdk.ability.ListTagAbility",
         "description": "",
         "type": "page"
       }
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/Credentials.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/Credentials.java
index 4846f048f602de4b9a59d0382110e6640dd9237a..2735a7a92218b19c2ce9200db2d4da414b206ac4 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/Credentials.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/Credentials.java
@@ -38,6 +38,9 @@ public class Credentials {
 
 	/**
 	 * Creates a new credentials for the service host url, and the application id.
+	 *
+	 * @param url url
+	 * @param applicationId applicationId
 	 */
 	public Credentials(String url, String applicationId) {
 		this.url = url;
@@ -47,9 +50,11 @@ public class Credentials {
 	public String getUrl() {
 		return url;
 	}
-	
+
 	/**
 	 * Sets the hosted service server url, i.e. http://www.paphuslivechat.com
+	 *
+	 * @param url url
 	 */
 	public void setUrl(String url) {
 		this.url = url;
@@ -61,6 +66,8 @@ public class Credentials {
 
 	/**
 	 * Sets the server host name, i.e. www.paphuslivechat.com
+	 *
+	 * @param host host
 	 */
 	public void setHost(String host) {
 		this.host = host;
@@ -72,6 +79,8 @@ public class Credentials {
 
 	/**
 	 * Sets an app url postfix, this is normally not required, i.e. "".
+	 *
+	 * @param app app
 	 */
 	public void setApp(String app) {
 		this.app = app;
@@ -79,6 +88,8 @@ public class Credentials {
 
 	/**
 	 * Returns your application's unique identifier.
+	 *
+	 * @return getApplicationId
 	 */
 	public String getApplicationId() {
 		return applicationId;
@@ -87,6 +98,8 @@ public class Credentials {
 	/**
 	 * Sets your application's unique identifier.
 	 * You can obtain your application id from your user details page on the hosting website.
+	 *
+	 * @param applicationId
 	 */
 	public void setApplicationId(String applicationId) {
 		this.applicationId = applicationId;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
deleted file mode 100644
index 97b136983accbc0132b1729ced2df22fef4f3f2e..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
+++ /dev/null
@@ -1,293 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk;
-
-import org.botlibre.sdk.config.ChannelConfig;
-import org.botlibre.sdk.config.UserConfig;
-
-import de.tavendo.autobahn.WebSocketConnection;
-import de.tavendo.autobahn.WebSocketConnectionHandler;
-
-/**
- * Connection class for a Live Chat, or chatroom connection.
- * A live chat connection is different than an SDKConnection as it is asynchronous,
- * and uses web sockets for communication.
- */
-public class LiveChatConnection {
-	protected boolean debug = false;
-	protected ChannelConfig channel;
-	protected UserConfig user;
-	protected Credentials credentials;
-    protected WebSocketConnection socket;
-    protected LiveChatListener listener;
-    protected boolean keepAlive = false;
-    protected Thread keepAliveThread;
-	
-    /**
-     * Create a new connection with the application credentials and the listener.
-     * The listener will be notified asynchronously of messages and events.
-     */
-	public LiveChatConnection(Credentials credentials, LiveChatListener listener) {
-		this.credentials = credentials;
-		this.listener = listener;
-	}
-	
-	/**
-	 * Connection to the live chat server channel.
-	 * Validate the user credentials.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void connect(ChannelConfig channel, UserConfig user) {
-		this.channel = channel;
-		this.user = user;
-		try {
-			this.socket = new WebSocketConnection();
-			this.socket.connect("ws://" + this.credentials.host + this.credentials.app
-						+ "/live/chat", new WebSocketConnectionHandler() {
-				@Override
-				public void onOpen() {
-					if (LiveChatConnection.this.user == null) {
-						LiveChatConnection.this.socket.sendTextMessage("connect " + LiveChatConnection.this.channel.id + " " + LiveChatConnection.this.credentials.applicationId);
-					} else {
-						LiveChatConnection.this.socket.sendTextMessage(
-								"connect " + LiveChatConnection.this.channel.id + " " + LiveChatConnection.this.user.user
-								+ " " + LiveChatConnection.this.user.token + " " + LiveChatConnection.this.credentials.applicationId);						
-					}
-				}
-
-				@Override
-				public void onTextMessage(String text) {
-			    	String user = "";
-			    	String message = text;
-			    	int index = text.indexOf(':');
-			    	if (index != -1) {
-			    		user = text.substring(0, index);
-			    		message = text.substring(index + 2, text.length());
-			    	}
-					if (user.equals("Online-xml")) {
-						return;
-					}
-					if (user.equals("Online")) {
-						LiveChatConnection.this.listener.updateUsers(message);
-						return;
-					}
-					
-					if (LiveChatConnection.this.keepAlive && user.equals("Info") && text.contains("pong")) {
-						return;
-					}
-					if (user.equals("Info")) {
-						LiveChatConnection.this.listener.info(text);
-						return;
-					}
-					if (user.equals("Error")) {
-						LiveChatConnection.this.listener.error(text);
-						return;
-					}
-					LiveChatConnection.this.listener.message(text);
-				}
-
-				@Override
-				public void onClose(int code, String reason) {
-					LiveChatConnection.this.listener.message("Info: Closed");
-					LiveChatConnection.this.listener.closed();
-				}
-			});
-		} catch (Exception exception) {
-			throw new SDKException(exception);
-		}
-	}
-
-	/**
-	 * Sent a text message to the channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 * Note, the listener will receive its own messages.
-	 */
-	public void sendMessage(String message) {
-		checkSocket();
-		if (message == null) {
-			return;
-		}
-		this.socket.sendTextMessage(message);
-	}
-
-	/**
-	 * Accept a private request.
-	 * This is also used by an operator to accept the top of the waiting queue.
-	 * This can also be used by a user to chat with the channel bot.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void accept() {
-		checkSocket();
-		this.socket.sendTextMessage("accept");
-	}
-
-	/**
-	 * Test the connection.
-	 * A pong message will be returned, this message will not be broadcast to the channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void ping() {
-		checkSocket();
-		this.socket.sendTextMessage("ping");
-	}
-
-	/**
-	 * Exit from the current private channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void exit() {
-		checkSocket();
-		this.socket.sendTextMessage("exit");
-	}
-
-	/**
-	 * Request a private chat session with a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void pvt(String user) {
-		checkSocket();
-		this.socket.sendTextMessage("pvt: " + user);
-	}
-
-	/**
-	 * Boot a user from the channel.
-	 * You must be a channel administrator to boot a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void boot(String user) {
-		checkSocket();
-		this.socket.sendTextMessage("boot: " + user);
-	}
-
-	/**
-	 * Send a private message to a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void whisper(String user, String message) {
-		checkSocket();
-		this.socket.sendTextMessage("whisper:" + user + ": " + message);
-	}
-
-	/**
-	 * Disconnect from the channel.
-	 */
-	public void disconnect() {
-    	this.keepAlive = false;
-    	if (this.keepAliveThread != null) {
-    		this.keepAliveThread.interrupt();
-    	}
-    	if (this.socket != null) {
-    		this.socket.disconnect();
-    	}
-	}
- 
-    protected void runKeepAlive() {
-    	this.keepAliveThread = new Thread() {
-    		public void run() {
-    			while (keepAlive) {
-	    			sendMessage("ping");
-	    			try {
-	    				Thread.sleep(600000);
-	    			} catch (InterruptedException exception) {
-	    				return;
-	    			}
-    			}
-    		}
-    	};
-    	this.keepAliveThread.start();
-    }
-    
-    public boolean isDebug() {
-		return debug;
-	}
-
-	/**
-	 * Enable debugging messages (logged to System.out).
-	 */
-	public void setDebug(boolean debug) {
-		this.debug = debug;
-	}
-
-	/**
-	 * Return the current channel.
-	 */
-	public ChannelConfig getChannel() {
-		return channel;
-	}
-
-	protected void setChannel(ChannelConfig channel) {
-		this.channel = channel;
-	}
-
-	/**
-	 * Return the current user.
-	 */
-	public UserConfig getUser() {
-		return user;
-	}
-
-	protected void setUser(UserConfig user) {
-		this.user = user;
-	}
-
-	/**
-	 * Return the current application credentials.
-	 */
-	public Credentials getCredentials() {
-		return credentials;
-	}
-
-	protected void setCredentials(Credentials credentials) {
-		this.credentials = credentials;
-	}
-
-	public LiveChatListener getListener() {
-		return listener;
-	}
-
-	public void setListener(LiveChatListener listener) {
-		this.listener = listener;
-	}
-
-	/**
-	 * Return if the connection will be kept alive, and not allowed to timeout due to inAbility.
-	 */
-	public boolean isKeepAlive() {
-		return keepAlive;
-	}
-
-	/**
-	 * Set if the connection should be kept alive, and not allowed to timeout due to inAbility.
-	 */
-	public void setKeepAlive(boolean keepAlive) {
-		this.keepAlive = keepAlive;
-    	if (this.keepAlive) {
-    		runKeepAlive();
-    	} else if (this.keepAliveThread != null) {
-    		this.keepAliveThread.interrupt();
-    		this.keepAliveThread = null;
-    	}
-    }
-	
-	protected void checkSocket() {
-		if (this.socket == null) {
-			throw new SDKException("Not connected");
-		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/MainAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/MainAbility.java
index 4b0357cb0c2dac456cfcb2626cbaab54da3b45ed..87cfdbb4f834cae8ca36aa62ce24ae0d361bcb51 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/MainAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/MainAbility.java
@@ -1,26 +1,25 @@
 package org.botlibre.sdk;
 
-import org.botlibre.sdk.activityy.BotSearchAbility;
-import org.botlibre.sdk.activityy.CreateUserAbility;
-import org.botlibre.sdk.activityy.HelpAbility;
-import org.botlibre.sdk.activityy.LibreAbility;
-import org.botlibre.sdk.activityy.ListTemplateView;
-import org.botlibre.sdk.activityy.LoginAbility;
-import org.botlibre.sdk.activityy.actions.HttpAction;
-import org.botlibre.sdk.activityy.actions.HttpConnectAction;
-import org.botlibre.sdk.activityy.actions.HttpFetchAction;
-import org.botlibre.sdk.activityy.actions.HttpFetchActionOffline;
-import org.botlibre.sdk.activityy.actions.HttpFetchOrCreateAction;
-import org.botlibre.sdk.activityy.actions.HttpGetImageAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.actions.HttpGetTemplatesAction;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.avatar.AvatarSelection;
-import org.botlibre.sdk.activityy.dialog.LanguageDialogBuilder;
-import org.botlibre.sdk.activityy.dialog.SpinnerDialogBuilder;
-import org.botlibre.sdk.activityy.listener.LanguageListener;
-import org.botlibre.sdk.activityy.listener.SelectListener;
-import org.botlibre.sdk.activityy.war.StartWarAbility;
+import org.botlibre.sdk.ability.BotSearchAbility;
+import org.botlibre.sdk.ability.CreateUserAbility;
+import org.botlibre.sdk.ability.HelpAbility;
+import org.botlibre.sdk.ability.LibreAbility;
+import org.botlibre.sdk.ability.ListTemplateView;
+import org.botlibre.sdk.ability.LoginAbility;
+import org.botlibre.sdk.ability.actions.HttpAction;
+import org.botlibre.sdk.ability.actions.HttpConnectAction;
+import org.botlibre.sdk.ability.actions.HttpFetchAction;
+import org.botlibre.sdk.ability.actions.HttpFetchActionOffline;
+import org.botlibre.sdk.ability.actions.HttpFetchOrCreateAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.actions.HttpGetTemplatesAction;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.avatar.AvatarSelection;
+import org.botlibre.sdk.ability.dialog.LanguageDialogBuilder;
+import org.botlibre.sdk.ability.dialog.SpinnerDialogBuilder;
+import org.botlibre.sdk.ability.listener.LanguageListener;
+import org.botlibre.sdk.ability.listener.SelectListener;
+import org.botlibre.sdk.ability.war.StartWarAbility;
 import org.botlibre.sdk.config.AvatarConfig;
 import org.botlibre.sdk.config.AvatarMedia;
 import org.botlibre.sdk.config.BotModeConfig;
@@ -130,7 +129,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     /**
      * If you are building a single instance app, then you can set the instance id or name here,
-     * and use this activity to launch it.
+     * and use this  to launch it.
      */
     public static String launchInstanceId = ""; // i.e. "171"
     public static String launchInstanceName = "Pizza Bot"; // i.e. "Help Bot"
@@ -141,7 +140,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     /**
      * If you are building a single instance app, then you can set the launchType to
-     * have this activity launch the bot, forum, or channel.
+     * have this  launch the bot, forum, or channel.
      */
     public static LaunchType launchType = LaunchType.Browse;
 
@@ -448,7 +447,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     /**
-     * @param uri The Uri to check.
+     * Whether the Uri authority is DownloadsProvider.
+     *
+     * @param uri uri
      * @return Whether the Uri authority is DownloadsProvider.
      */
     public static boolean isDownloadsDocument(Uri uri) {
@@ -456,7 +457,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     /**
-     * @param uri The Uri to check.
+     * Whether the Uri authority is MediaProvider.
+     *
+     * @param uri uri
      * @return Whether the Uri authority is MediaProvider.
      */
     public static boolean isMediaDocument(Uri uri) {
@@ -464,10 +467,11 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     /**
-     * @param uri The Uri to check.
+     * Whether the Uri authority is Google Photos.
+     *
+     * @param uri uri
      * @return Whether the Uri authority is Google Photos.
      */
-
     public static boolean isGooglePhotosUri(Uri uri) {
         return "com.google.ohos.apps.photos.content".equals(uri.getDecodedAuthority());
     }
@@ -493,7 +497,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     @SuppressWarnings("rawtypes")
-    public static Class getActivity(WebMediumConfig config) {
+    public static Class getAbility(WebMediumConfig config) {
         if (config instanceof ChannelConfig) {
 //            return ChannelAbility.class; //====================
         } else if (config instanceof ForumConfig) {
@@ -512,7 +516,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         return null;
     }
 
-    public static void error(String message, Exception exception, Ability activity) {
+    public static void error(String message, Exception exception, Ability ability) {
         try {
             if (DEBUG) {
                 System.out.println(String.valueOf(message));
@@ -526,13 +530,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             if (message.contains("<html>")) {
                 message = "Server Error, ensure you are connected to the Internet";
             }
-            MainAbility.showMessage(null,message, activity);
+            MainAbility.showMessage(null, message, ability);
         } catch (Throwable error) {
             error.printStackTrace();
         }
     }
 
-    public static void errorInfo(int type,String message, Exception exception, Ability activity) {
+    public static void errorInfo(int type, String message, Exception exception, Ability ability) {
         try {
             if (DEBUG) {
                 System.out.println(String.valueOf(message));
@@ -546,29 +550,29 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             if (message.contains("<html>")) {
                 message = "Server Error, ensure you are connected to the Internet";
             }
-            MainAbility.showMessageInfo(type,null,message, activity);
+            MainAbility.showMessageInfo(type, null, message, ability);
         } catch (Throwable error) {
             error.printStackTrace();
         }
     }
 
-    public static void showMessage(String title, String message, Ability activity) {
-        CommonDialog mCommonDialog = new CommonDialog(activity);
+    public static void showMessage(String title, String message, Ability ability) {
+        CommonDialog mCommonDialog = new CommonDialog(ability);
         Optional<Display>
-                display = DisplayManager.getInstance().getDefaultDisplay(activity);
+                display = DisplayManager.getInstance().getDefaultDisplay(ability);
         DisplayAttributes displayAttributes = display.get().getAttributes();
-        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(activity).
+        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability).
                 parse(ResourceTable.Layout_content_dialog,
                         null, false);
         mCommonDialog.setContentCustomComponent(layout)
                 .setAlignment(LayoutAlignment.CENTER)
-                .setSize(displayAttributes.width-100,DirectionalLayout.LayoutConfig.MATCH_CONTENT)
+                .setSize(displayAttributes.width - 100, DirectionalLayout.LayoutConfig.MATCH_CONTENT)
                 .setAutoClosable(false)
                 .setTransparent(false)
                 .show();
 
-        Text ok = (Text)layout.findComponentById(ResourceTable.Id_ok);
-        Text contentinfo = (Text)layout.findComponentById(ResourceTable.Id_contentinfo);
+        Text ok = (Text) layout.findComponentById(ResourceTable.Id_ok);
+        Text contentinfo = (Text) layout.findComponentById(ResourceTable.Id_contentinfo);
         if (message != null) {
             contentinfo.setText(message);
         }
@@ -580,23 +584,23 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public void showLogin(String title, String message, Ability activity) {
-        CommonDialog mCommonDialog = new CommonDialog(activity);
+    public void showLogin(String title, String message, Ability ability) {
+        CommonDialog mCommonDialog = new CommonDialog(ability);
         Optional<Display>
-                display = DisplayManager.getInstance().getDefaultDisplay(activity);
+                display = DisplayManager.getInstance().getDefaultDisplay(ability);
         DisplayAttributes displayAttributes = display.get().getAttributes();
-        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(activity).
+        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability).
                 parse(ResourceTable.Layout_content_dialog,
                         null, false);
         mCommonDialog.setContentCustomComponent(layout)
                 .setAlignment(LayoutAlignment.CENTER)
-                .setSize(displayAttributes.width - 100,DirectionalLayout.LayoutConfig.MATCH_CONTENT)
+                .setSize(displayAttributes.width - 100, DirectionalLayout.LayoutConfig.MATCH_CONTENT)
                 .setAutoClosable(false)
                 .setTransparent(false)
                 .show();
 
-        Text ok = (Text)layout.findComponentById(ResourceTable.Id_ok);
-        Text contentinfo = (Text)layout.findComponentById(ResourceTable.Id_contentinfo);
+        Text ok = (Text) layout.findComponentById(ResourceTable.Id_ok);
+        Text contentinfo = (Text) layout.findComponentById(ResourceTable.Id_contentinfo);
         if (message != null) {
             contentinfo.setText(message);
         }
@@ -610,23 +614,24 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     public static Text execcontentinfo;
-    public static void showMessageInfo(int type,String title, String message, Ability activity) {
-        CommonDialog mCommonDialog = new CommonDialog(activity);
+
+    public static void showMessageInfo(int type, String title, String message, Ability ability) {
+        CommonDialog mCommonDialog = new CommonDialog(ability);
         Optional<Display>
-                display = DisplayManager.getInstance().getDefaultDisplay(activity);
+                display = DisplayManager.getInstance().getDefaultDisplay(ability);
         DisplayAttributes displayAttributes = display.get().getAttributes();
-        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(activity).
+        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability).
                 parse(ResourceTable.Layout_exception_dialog,
                         null, false);
         mCommonDialog.setContentCustomComponent(layout)
                 .setAlignment(LayoutAlignment.CENTER)
-                .setSize(displayAttributes.width - 100,displayAttributes.height - 200)
+                .setSize(displayAttributes.width - 100, displayAttributes.height - 200)
                 .setAutoClosable(false)
                 .setTransparent(false)
                 .show();
 
-        Text ok = (Text)layout.findComponentById(ResourceTable.Id_ok);
-        execcontentinfo = (Text)layout.findComponentById(ResourceTable.Id_execcontentinfo);
+        Text ok = (Text) layout.findComponentById(ResourceTable.Id_ok);
+        execcontentinfo = (Text) layout.findComponentById(ResourceTable.Id_execcontentinfo);
         if (message != null) {
             execcontentinfo.setText(message);
         }
@@ -647,12 +652,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public static void showMessage(String message, Ability activity) {
-        showMessage(null, message, activity);
+    public static void showMessage(String message, Ability ability) {
+        showMessage(null, message, ability);
     }
 
-    public static void prompt(String message, Ability activity, TextField text, IDialog.ClickedListener listener) {
-        CommonDialog dialog = new CommonDialog(activity);
+    public static void prompt(String message, Ability ability, TextField text, IDialog.ClickedListener listener) {
+        CommonDialog dialog = new CommonDialog(ability);
         dialog.setContentText(message);
         dialog.setContentCustomComponent(text);
         dialog.setButton(0, "OK", listener);
@@ -691,8 +696,8 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         builder.show();
     }
 
-    public static void confirm(String message, Ability activity, Boolean cancelable, IDialog.ClickedListener listener) {
-        CommonDialog dialog = new CommonDialog(activity);
+    public static void confirm(String message, Ability ability, Boolean cancelable, IDialog.ClickedListener listener) {
+        CommonDialog dialog = new CommonDialog(ability);
         dialog.setTitleText("Pizza Bot");
         dialog.setContentText(message);
         dialog.setButton(0, "Yes", listener);
@@ -703,10 +708,10 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         dialog.show();
     }
 
-    public static List<InstanceConfig> getAllTemplates(Ability activity) {
+    public static List<InstanceConfig> getAllTemplates(Ability ability) {
         if (templates == null) {
             try {
-                HttpGetTemplatesAction action = new HttpGetTemplatesAction(activity);
+                HttpGetTemplatesAction action = new HttpGetTemplatesAction(ability);
                 action.postExecute(action.execute().get());
                 if (action.getException() != null) {
                     templates = new ArrayList<InstanceConfig>();
@@ -824,7 +829,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         hd = isTablet(this);
     }
 
-    public void initChat(){
+    public void initChat() {
         chatButton = (Button) findComponentById(ResourceTable.Id_chatButton); // chat
         chatButton.setClickedListener(new Component.ClickedListener() {
             @Override
@@ -834,7 +839,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public void initMain(){
+    public void initMain() {
         spin = (Button) findComponentById(ResourceTable.Id_selectButton); // 底部类型选择
         spin.setClickedListener(new Component.ClickedListener() {
             @Override
@@ -895,7 +900,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public void initBrowse(){
+    public void initBrowse() {
         chatButton = (Button) findComponentById(ResourceTable.Id_chatButton);
         chatButton.setClickedListener(new Component.ClickedListener() {
             @Override
@@ -930,6 +935,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             }
         });
     }
+
     //动态权限
     private void reqPermissions() {
         mPermissions.removeIf(perM -> verifySelfPermission(perM) == PERMISSION_GRANTED || !canRequestPermission(perM));
@@ -944,8 +950,8 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     /**
      * 权限回调
      *
-     * @param requestCode requestCode
-     * @param ss ss
+     * @param requestCode  requestCode
+     * @param ss           ss
      * @param grantResults grantResults
      */
     @Override
@@ -977,7 +983,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         launchInstanceId = oneItem.getId();
     }
 
-    @SuppressWarnings({ "unchecked", "rawtypes" })
+    @SuppressWarnings({"unchecked", "rawtypes"})
     public void resetView() {
         menuButton = (Button) findComponentById(ResourceTable.Id_menuButton); // 菜单选择
         menuButton.setClickedListener(new Component.ClickedListener() {
@@ -988,38 +994,21 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
 
 
-
         if (domain != null) {
 //            setTitle(Utils.stripTags(domain.name));
-            HttpGetImageAction.fetchImage(this, domain.avatar, null); //-----------------
 //            HttpGetImageAction.fetchImage(this, domain.avatar, (Image) findComponentById(ResourceTable.Id_splash));
         }
 
         if (MainAbility.user == null) {
             findComponentById(ResourceTable.Id_viewUserButton).setVisibility(HIDE);
-            //findViewById(R.id.logoutButton).setVisibility(View.GONE);
-            //findViewById(R.id.loginButton).setVisibility(View.VISIBLE);
         } else {
-            //findViewById(R.id.logoutButton).setVisibility(View.VISIBLE);
-            //findViewById(R.id.loginButton).setVisibility(View.GONE);
             findComponentById(ResourceTable.Id_viewUserButton).setVisibility(VISIBLE);
-            //HttpGetImageAction.fetchImage(this, MainActivity.user.avatar, findViewById(R.id.viewUserButton));
         }
         resetMenu(this.menu);
         resetLast();
     }
 
     public void resetLast() {
-//        String type = MainAbility.defaultType;
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);  // 需要放入 adapter中做判断
-//        if (spin != null) {
-//            type = (String) spin.getSelectedItem();
-//            if (type.equals("Chat Bot Wars")) {
-//                spin.setSelection(0);
-//                war(null);
-//                return;
-//            }
-//        }
         if (type.equals("Chat Bot Wars")) {
             war();
             return;
@@ -1212,8 +1201,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         editor.delete("deviceVoice");
         editor.flushSync();
 
-        HttpGetImageAction.clearFileCache(this);
-
         Intent intent = getIntent();
         terminateAbility();
         startAbility(intent);
@@ -1228,7 +1215,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         DirectionalLayout menuComponent = (DirectionalLayout) LayoutScatter.getInstance(this)
                 .parse(ResourceTable.Layout_menu_main, null, false);
         menuDialog.setCustomComponent(menuComponent);
-        menuDialog.showOnCertainPosition(1,displayAttributes.width,-displayAttributes.width + 150);
+        menuDialog.showOnCertainPosition(1, displayAttributes.width, -displayAttributes.width + 150);
         menuDialog.setAutoClosable(true);
         Text statistics = (Text) menuComponent.findComponentById(ResourceTable.Id_title);
         Text changelanguage = (Text) menuComponent.findComponentById(ResourceTable.Id_changelanguage);
@@ -1236,7 +1223,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         Text searchinfo = (Text) menuComponent.findComponentById(ResourceTable.Id_searchinfo);
         Text helpopt = (Text) menuComponent.findComponentById(ResourceTable.Id_helpopt);
         Text contentrating = (Text) menuComponent.findComponentById(ResourceTable.Id_contentrating);
-        menuDialog.setAlignment(LayoutAlignment.RIGHT|LayoutAlignment.TOP);
+        menuDialog.setAlignment(LayoutAlignment.RIGHT | LayoutAlignment.TOP);
         menuDialog.show();
 
         Text loginButton = (Text) menuComponent.findComponentById(ResourceTable.Id_loginButton);
@@ -1287,7 +1274,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         changelanguage.setClickedListener(new Component.ClickedListener() {
             @Override
             public void onClick(Component component) {
-                changeLanguage(MainAbility.this,null);
+                changeLanguage(MainAbility.this, null);
                 menuDialog.destroy();
             }
         });
@@ -1323,55 +1310,27 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     public void createUser() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//
-//        Intent intent = new Intent(this, CreateUserActivity.class);
-//        startActivity(intent);
         startOpenAbility(this, CreateUserAbility.class.getName());
     }
 
     public void editUser() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//
-//        Intent intent = new Intent(this, EditUserActivity.class);
-//        startActivity(intent);
-//        startOpenAbility(this, EditUserAbility.class.getName()); //================
     }
 
-    public static void setOnline(boolean result){
-        if(result){
+    public static void setOnline(boolean result) {
+        if (result) {
             connection = remoteConnection;
-        }else{
+        } else {
             connection = localConnection;
         }
         online = result;
     }
 
     public void help() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//        super.help(view);
         startOpenAbility(this, HelpAbility.class.getName());
     }
 
     public void viewUser() {
         viewUser = user;
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-
-//        Intent intent = new Intent(this, ViewUserActivity.class);
-//        startActivity(intent);
-//        startOpenAbility(this, ViewUserAbility.class.getName()); //================
     }
 
     public void openWebsite() {
@@ -1389,7 +1348,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     public void createInstance() {
         if (user == null) {
-            showLogin("","You must sign in first",this);
+            showLogin("", "You must sign in first", this);
             return;
         }
 //        Spinner spin = (Spinner) findViewById(getResources().getIdentifier("typeSpin", "id", getPackageName()));
@@ -1401,75 +1360,28 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
         if (type.equals("Bots")) {
             MainAbility.template = "";
-//            Intent intent = new Intent(this, CreateBotActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateBotAbility.class.getName()); //================
-        } else if (type.equals("Forums")) {
-//            Intent intent = new Intent(this, CreateForumActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateForumAbility.class.getName()); //================
-        } else if (type.equals("Live Chat")) {
-//            Intent intent = new Intent(this, CreateChannelActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateChannelAbility.class.getName()); //================
-        } else if (type.equals("Domains")) {
-//            Intent intent = new Intent(this, CreateDomainActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateDomainAbility.class.getName()); //================
-        } else if (type.equals("Avatars")) {
-//            Intent intent = new Intent(this, CreateAvatarActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateAvatarAbility.class.getName()); //================
-        } else if (type.equals("Scripts")) {
-//            Intent intent = new Intent(this, CreateScriptActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateScriptAbility.class.getName()); //================
-        } else if (type.equals("Graphics")) {
-//            Intent intent = new Intent(this, CreateGraphicActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateGraphicAbility.class.getName()); //================
         }
     }
 
     public void search() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
         if (type.equals("Bots")) {
-//            Intent intent = new Intent(this, BotSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
         } else if (type.equals("Forums")) {
-//            Intent intent = new Intent(this, ForumSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
         } else if (type.equals("Live Chat")) {
-//            Intent intent = new Intent(this, ChannelSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
         } else if (type.equals("Domains")) {
-//            Intent intent = new Intent(this, DomainSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
         } else if (type.equals("Avatars")) {
-//            Intent intent = new Intent(this, AvatarSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
         } else if (type.equals("Scripts")) {
-//            Intent intent = new Intent(this, ScriptSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
         } else if (type.equals("Graphics")) {
-//            Intent intent = new Intent(this, GraphicSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
-        }else if (type.equals("Chat Bot Wars")) {
-//            Intent intent = new Intent(this, GraphicSearchActivity.class);
-//            startActivity(intent);
+        } else if (type.equals("Chat Bot Wars")) {
             startOpenAbility(this, BotSearchAbility.class.getName());
         }
     }
@@ -1568,12 +1480,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         // the launch type is bot.
         if (MainAbility.launchType == LaunchType.Bot) {
             if (!MicroMemory.checkExists()) {
-                //ListTemplateView.offlineTemplate = true;
-                //Intent intent = new Intent(MainActivity.this, ListTemplateView.class);
-                //startActivity(intent);
 
                 config = new InstanceConfig();
-                OfflineTemplateConfig templates = new OfflineTemplateConfig(ResourceTable.Media_bot,"Pizza Bot","",""+0,0);
+                OfflineTemplateConfig templates = new OfflineTemplateConfig(ResourceTable.Media_bot, "Pizza Bot", "", "" + 0, 0);
                 //saving a template number for getting the icons and pictures of the bot
                 saveAllData(MainAbility.launchInstanceName = templates.getTitle(), MainAbility.launchInstanceId = templates.getId(), MainAbility.templateID = 0);
                 config.id = MainAbility.launchInstanceId;
@@ -1598,7 +1507,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
-    public void saveAllData(String instanceId, String instanceName, int id){
+    public void saveAllData(String instanceId, String instanceName, int id) {
 //        Preferences cookies = MainAbility.current.getPreferences(Context.MODE_PRIVATE).edit();
         Preferences cookies = PreferencesUtils.getPreferences(this);
         cookies.putString("instanceID", instanceId);
@@ -1632,6 +1541,8 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     /**
      * Start a chat session with the user's personal instance.
+     *
+     * @param view view
      */
     public void launchMyBot(View view) {
         if (user == null) {
@@ -1655,7 +1566,8 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     public static String selectInfo = "";
     Text languageselect;
-    @SuppressWarnings({ "rawtypes", "unchecked" })
+
+    @SuppressWarnings({"rawtypes", "unchecked"})
     public void changeLanguage(Ability activty, final IDialog.ClickedListener listener) {
         Optional<Display>
                 display = DisplayManager.getInstance().getDefaultDisplay(this);
@@ -1667,7 +1579,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         CommonDialog dialog = new CommonDialog(MainAbility.this);
         setOnline(true);
 //        dialog.setTitleText("    Languages");
-        dialog.setSize(displayAttributes.width - 100,displayAttributes.width - 300);
+        dialog.setSize(displayAttributes.width - 100, displayAttributes.width - 300);
 //        dialog.setContentText("Select your language");
         dialog.setContentCustomComponent(layout);
         dialog.show();
@@ -1676,7 +1588,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         Text ok = (Text) layout.findComponentById(ResourceTable.Id_ok);
         Text cancel = (Text) layout.findComponentById(ResourceTable.Id_cancel);
 
-        SpinnerAdapter spinnerAdapter = new SpinnerAdapter(this,MainAbility.languages);
+        SpinnerAdapter spinnerAdapter = new SpinnerAdapter(this, MainAbility.languages);
         languageselect.setClickedListener(new Component.ClickedListener() {//弹出选择语言对话框
             @Override
             public void onClick(Component component) {
@@ -1690,15 +1602,15 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             index = Arrays.asList(MainAbility.languages).indexOf(MainAbility.voice.language);
         }
 //        spin.setSelection(index);
-        if(MainAbility.voice.language==null||MainAbility.voice.language.isEmpty()){
+        if (MainAbility.voice.language == null || MainAbility.voice.language.isEmpty()) {
             languageselect.setText(MainAbility.languages[0] + "");
-        }else{
+        } else {
             languageselect.setText(MainAbility.voice.language + "");
         }
 
-        if (MainAbility.voice != null && MainAbility.voice.language != null){
+        if (MainAbility.voice != null && MainAbility.voice.language != null) {
             for (int i = 0; i < spinnerAdapter.getCount(); i++) {
-                if(MainAbility.languages[i].contains(MainAbility.voice.language + " - ")){
+                if (MainAbility.languages[i].contains(MainAbility.voice.language + " - ")) {
 //                    spin.setSelection(i);
                     selectInfo = MainAbility.languages[i];
                 }
@@ -1754,19 +1666,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public static void readZipAvatars(Ability activity, String fileName) {
-        // this is only for letting Julie Assistance Avatar works, since there
-        // is only one file called
-        // "Julie" I will have to take this name and read the file from the
-        // method @readZipAvatars.
+    public static void readZipAvatars(Ability ability, String fileName) {
         String args[] = fileName.split("\\s+");
-        // ex: Julie = Julie
-        // Julie Assistant = Julie
-        // Its only going to take one name
         try {
-//            GetAvatarAction avatar = new GetAvatarAction(activity);
-//            avatar.readZipFile(args[0] + ".zip");
-//            MicroConnection.avatarConfig = avatar.instance;
         } catch (Exception ignore) {
         }
     }
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/SDKConnection.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
index 7dc7f7db821aa55b62b05a2cb1fc139543ab927e..fe1ac75f7e81a2765c563c747cdf003c45a3b5b6 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
@@ -22,15 +22,14 @@ import java.io.ByteArrayOutputStream;
 import java.io.File;
 import java.io.FileInputStream;
 import java.io.IOException;
-import java.io.StringReader;
 import java.net.URL;
 import java.util.ArrayList;
 import java.util.List;
-
 import com.franmontiel.persistentcookiejar.ClearableCookieJar;
 import com.franmontiel.persistentcookiejar.PersistentCookieJar;
 import com.franmontiel.persistentcookiejar.cache.SetCookieCache;
 import com.franmontiel.persistentcookiejar.persistence.SharedPrefsCookiePersistor;
+import ohos.agp.components.element.ShapeElement;
 import org.botlibre.sdk.config.AvatarConfig;
 import org.botlibre.sdk.config.AvatarMedia;
 import org.botlibre.sdk.config.AvatarMessage;
@@ -55,7 +54,6 @@ import org.botlibre.sdk.config.ResponseSearchConfig;
 import org.botlibre.sdk.config.ScriptConfig;
 import org.botlibre.sdk.config.ScriptSourceConfig;
 import org.botlibre.sdk.config.Speech;
-import org.botlibre.sdk.config.TrainingConfig;
 import org.botlibre.sdk.config.UserAdminConfig;
 import org.botlibre.sdk.config.UserConfig;
 import org.botlibre.sdk.config.UserMessageConfig;
@@ -84,12 +82,7 @@ import org.apache.http.protocol.BasicHttpContext;
 import org.apache.http.protocol.HTTP;
 import org.apache.http.protocol.HttpContext;
 import org.apache.http.util.EntityUtils;
-import org.w3c.dom.Document;
 import org.w3c.dom.Element;
-import org.xml.sax.InputSource;
-
-import javax.xml.parsers.DocumentBuilder;
-import javax.xml.parsers.DocumentBuilderFactory;
 
 /**
  * Connection class for a REST service connection.
@@ -122,33 +115,27 @@ public class SDKConnection {
 	
 	protected SDKException exception;
 
-	/**
-	 * Return the name of the default user image.
-	 */
-	public static String defaultUserImage() {
-		return "images/user-thumb.jpg";
-	}
-	
 	/**
 	 * Create an SDK connection.
 	 */
 	public SDKConnection() {
 	}
-	
+
 	/**
-	 * Create an SDK connection with the credentials.
 	 * Use the Credentials subclass specific to your server.
+	 *
+	 * @param credentials credentials
 	 */
 	public SDKConnection(Credentials credentials) {
 		this.credentials = credentials;
 		this.url = credentials.url;
 	}
-	
+
 	/**
-	 * Validate the user credentials (password, or token).
-	 * The user details are returned (with a connection token, password removed).
 	 * The user credentials are soted in the connection, and used on subsequent calls.
-	 * An SDKException is thrown if the connect failed.
+	 *
+	 * @param config config
+	 * @return The user credentials are soted in the connection, and used on subsequent calls.
 	 */
 	public UserConfig connect(UserConfig config) {
 		config.addCredentials(this);
@@ -168,9 +155,14 @@ public class SDKConnection {
 		}
 		return this.user;
 	}
-	
+
 	/**
 	 * Execute the custom API.
+	 *
+	 * @param api api
+	 * @param config config
+	 * @param result result
+	 * @return Execute the custom API.
 	 */
 	public Config custom(String api, Config config, Config result) {
 		config.addCredentials(this);
@@ -187,41 +179,32 @@ public class SDKConnection {
 		}
 		return result;
 	}
-	
-	/**
-	 * Connect to the live chat channel and return a LiveChatConnection.
-	 * A LiveChatConnection is separate from an SDKConnection and uses web sockets for
-	 * asynchronous communication.
-	 * The listener will be notified of all messages.
-	 */
-	public LiveChatConnection openLiveChat(ChannelConfig channel, LiveChatListener listener) {
-		LiveChatConnection connection = new LiveChatConnection(this.credentials, listener);
-		connection.connect(channel, this.user);
-		return connection;
-	}
-	
+
 	/**
-	 * Connect to the domain.
-	 * A domain is an isolated content space.
 	 * Any browse or query request will be specific to the domain's content.
-	 */	
+	 *
+	 * @param config config
+	 * @return Any browse or query request will be specific to the domain's content.
+	 */
 	public DomainConfig connect(DomainConfig config) {
 		this.domain = fetch(config);
 		return this.domain;
 	}
-	
+
 	/**
-	 * Disconnect from the connection.
 	 * An SDKConnection does not keep a live connection, but this resets its connected user and domain.
-	 */	
+	 */
 	public void disconnect() {
 		this.user = null;
 		this.domain = null;
 	}
-	
+
 	/**
 	 * Fetch the user details.
-	 */	
+	 *
+	 * @param config config
+	 * @return Fetch the user details.
+	 */
 	public UserConfig fetch(UserConfig config) {
 		config.addCredentials(this);
 		String xml = POST(this.url + "/view-user", config.toXML());
@@ -238,10 +221,13 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Fetch the URL for the image from the server.
-	 */	
+	 *
+ 	 * @param image image
+	 * @return Fetch the URL for the image from the server.
+	 */
 	public URL fetchImage(String image) {
 		try {
 			return new URL("http://" + this.credentials.host + this.credentials.app + "/" + image);
@@ -250,10 +236,13 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Fetch the forum post details for the forum post id.
-	 */	
+	 *
+	 * @param config config
+	 * @return Fetch the forum post details for the forum post id.
+	 */
 	public ForumPostConfig fetch(ForumPostConfig config) {
 		config.addCredentials(this);
 		String xml = POST(this.url + "/check-forum-post", config.toXML());
@@ -273,6 +262,9 @@ public class SDKConnection {
 
 	/**
 	 * Fetch the issue details for the issue id.
+	 *
+	 * @param config config
+	 * @return Fetch the issue details for the issue id.
 	 */
 	public IssueConfig fetch(IssueConfig config) {
 		config.addCredentials(this);
@@ -290,9 +282,13 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Create a new user.
+	 *
+	 * @param ability ability
+	 * @param config config
+	 * @return Create a new user.
 	 */
 	public UserConfig create(Ability ability,UserConfig config) {
 		config.addCredentials(this);
@@ -311,10 +307,12 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Create a new forum post.
-	 * You must set the forum id for the post.
+	 *
+	 * @param config config
+	 * @return Create a new forum post.
 	 */
 	public ForumPostConfig create(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -335,7 +333,9 @@ public class SDKConnection {
 
 	/**
 	 * Create a new issue.
-	 * You must set the issue tracker id for the issue.
+	 *
+	 * @param config config
+	 * @return Create a new issue.
 	 */
 	public IssueConfig create(IssueConfig config) {
 		config.addCredentials(this);
@@ -356,6 +356,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new file/image/media attachment for a chat channel.
+	 *
+	 * @param file file
+	 * @param config config
+	 * @return Create a new file/image/media attachment for a chat channel.
 	 */
 	public MediaConfig createChannelFileAttachment(String file, MediaConfig config) {
 		config.addCredentials(this);
@@ -376,6 +380,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new image attachment for a chat channel.
+	 *
+	 * @param file file
+	 * @param config config
+	 * @return Create a new image attachment for a chat channel.
 	 */
 	public MediaConfig createChannelImageAttachment(String file, MediaConfig config) {
 		config.addCredentials(this);
@@ -396,6 +404,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new file/image/media attachment for an issue tracker.
+	 *
+	 * @param file file
+	 * @param config config
+	 * @return Create a new file/image/media attachment for an issue tracker.
 	 */
 	public MediaConfig createIssueTrackerFileAttachment(String file, MediaConfig config) {
 		config.addCredentials(this);
@@ -416,6 +428,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new image attachment for an issue tracker.
+	 *
+	 * @param file file
+	 * @param config config
+	 * @return Create a new image attachment for an issue tracker.
 	 */
 	public MediaConfig createIssueTrackerImageAttachment(String file, MediaConfig config) {
 		config.addCredentials(this);
@@ -436,6 +452,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new image attachment for an issue tracker.
+	 *
+	 * @param bitmap bitmap
+	 * @param config config
+	 * @return Create a new image attachment for an issue tracker.
 	 */
 	public MediaConfig createIssueTrackerImageAttachment(PixelMap bitmap, MediaConfig config) {
 		config.addCredentials(this);
@@ -453,10 +473,12 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Create a reply to a forum post.
-	 * You must set the parent id for the post replying to.
+	 *
+	 * @param config config
+	 * @return Create a reply to a forum post.
 	 */
 	public ForumPostConfig createReply(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -474,20 +496,23 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Create a user message.
-	 * This can be used to send a user a direct message.
-	 * SPAM will cause your account to be deleted.
+	 *
+	 * @param config config
 	 */
 	public void createUserMessage(UserMessageConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/create-user-message", config.toXML());
 	}
-	
+
 	/**
 	 * Fetch the content details from the server.
-	 * The id or name and domain of the object must be set.
+	 *
+	 * @param config config
+	 * @param <T> <T>
+	 * @return Fetch the content details from the server.
 	 */
 	@SuppressWarnings("unchecked")
 	public <T extends WebMediumConfig> T fetch(T config) {
@@ -510,6 +535,10 @@ public class SDKConnection {
 	/**
 	 * Create the new content.
 	 * The content will be returned with its new id.
+	 *
+	 * @param config config
+	 * @param <T> <T>
+	 * @return Create the new content.
 	 */
 	@SuppressWarnings("unchecked")
 	public <T extends WebMediumConfig> T create(T config) {
@@ -528,9 +557,13 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Update the content.
+	 *
+	 * @param config config
+	 * @param <T> <T>
+	 * @return Update the content.
 	 */
 	@SuppressWarnings("unchecked")
 	public <T extends WebMediumConfig> T update(T config) {
@@ -549,9 +582,12 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Update the forum post.
+	 *
+	 * @param config config
+	 * @return Update the forum post.
 	 */
 	public ForumPostConfig update(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -572,6 +608,9 @@ public class SDKConnection {
 
 	/**
 	 * Update the issue.
+	 *
+	 * @param config config
+	 * @return Update the issue.
 	 */
 	public IssueConfig update(IssueConfig config) {
 		config.addCredentials(this);
@@ -592,7 +631,9 @@ public class SDKConnection {
 	
 	/**
 	 * Create or update the response.
-	 * This can also be used to flag, unflag, validate, or invalidate a response.
+	 *
+	 * @param config config
+	 * @return Create or update the response.
 	 */
 	public ResponseConfig saveResponse(ResponseConfig config) {
 		config.addCredentials(this);
@@ -613,7 +654,9 @@ public class SDKConnection {
 	
 	/**
 	 * Update the user details.
-	 * The password must be passed to allow the update.
+	 *
+	 * @param config config
+	 * @return Update the user details.
 	 */
 	public UserConfig update(UserConfig config) {
 		config.addCredentials(this);
@@ -632,9 +675,11 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Permanently delete the content with the id.
+	 *
+	 * @param config config
 	 */
 	public void delete(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -643,9 +688,11 @@ public class SDKConnection {
 			domain=null;
 		}
 	}
-	
+
 	/**
 	 * Permanently delete the forum post with the id.
+	 *
+	 * @param config config
 	 */
 	public void delete(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -654,54 +701,68 @@ public class SDKConnection {
 
 	/**
 	 * Permanently delete the issue with the id.
+	 *
+	 * @param config config
 	 */
 	public void delete(IssueConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/delete-issue", config.toXML());
 	}
-	
+
 	/**
 	 * Permanently delete the response, greetings, or default response with the response id (and question id).
+	 *
+	 * @param config config
 	 */
 	public void delete(ResponseConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/delete-response", config.toXML());
 	}
-	
+
 	/**
 	 * Permanently delete the avatar media.
+	 *
+	 * @param config config
 	 */
 	public void delete(AvatarMedia config) {
 		config.addCredentials(this);
 		POST(this.url + "/delete-avatar-media", config.toXML());
 	}
-	
+
 	/**
 	 * Permanently delete the avatar background.
+	 *
+	 * @param config config
 	 */
 	public void deleteAvatarBackground(AvatarConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/delete-avatar-background", config.toXML());
 	}
-	
+
 	/**
 	 * Save the avatar media tags.
+	 *
+	 * @param config config
 	 */
 	public void saveAvatarMedia(AvatarMedia config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-avatar-media", config.toXML());
 	}
-	
+
 	/**
 	 * Flag the content as offensive, a reason is required.
+	 *
+	 * @param config config
 	 */
 	public void flag(WebMediumConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/flag-" + config.getType(), config.toXML());
 	}
-	
+
 	/**
 	 * Subscribe for email updates for the post.
+	 *
+	 * @param config config
 	 */
 	public void subscribe(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -710,22 +771,28 @@ public class SDKConnection {
 
 	/**
 	 * Subscribe for email updates for the issue.
+	 *
+	 * @param config config
 	 */
 	public void subscribe(IssueConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/subscribe-issue", config.toXML());
 	}
-	
+
 	/**
 	 * Subscribe for email updates for the forum.
+	 *
+	 * @param config config
 	 */
 	public void subscribe(ForumConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/subscribe-forum", config.toXML());
 	}
-	
+
 	/**
 	 * Unsubscribe from email updates for the post.
+	 *
+	 * @param config config
 	 */
 	public void unsubscribe(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -734,70 +801,88 @@ public class SDKConnection {
 
 	/**
 	 * Unsubscribe from email updates for the issue.
+	 *
+	 * @param config config
 	 */
 	public void unsubscribe(IssueConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/unsubscribe-issue", config.toXML());
 	}
-	
+
 	/**
 	 * Unsubscribe from email updates for the forum.
+	 *
+	 * @param config config
 	 */
 	public void unsubscribe(ForumConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/unsubscribe-forum", config.toXML());
 	}
-	
+
 	/**
 	 * Thumbs up the content.
+	 *
+	 * @param config config
 	 */
 	public void thumbsUp(WebMediumConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/thumbs-up-" + config.getType(), config.toXML());
 	}
-	
+
 	/**
 	 * Thumbs down the content.
+	 *
+	 * @param config config
 	 */
 	public void thumbsDown(WebMediumConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/thumbs-down-" + config.getType(), config.toXML());
 	}
-	
+
 	/**
 	 * Rate the content.
+	 *
+	 * @param config config
 	 */
 	public void star(WebMediumConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/star-" + config.getType(), config.toXML());
 	}
-	
+
 	/**
 	 * Thumbs up the content.
+	 *
+	 * @param config config
 	 */
 	public void thumbsUp(ForumPostConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/thumbs-up-post", config.toXML());
 	}
-	
+
 	/**
 	 * Thumbs down the content.
+	 *
+	 * @param config config
 	 */
 	public void thumbsDown(ForumPostConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/thumbs-down-post", config.toXML());
 	}
-	
+
 	/**
 	 * Rate the content.
+	 *
+	 * @param config config
 	 */
 	public void star(ForumPostConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/star-post", config.toXML());
 	}
-	
+
 	/**
 	 * Flag the forum post as offensive, a reason is required.
+	 *
+	 * @param config config
 	 */
 	public void flag(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -806,6 +891,8 @@ public class SDKConnection {
 
 	/**
 	 * Thumbs up the content.
+	 *
+	 * @param config config
 	 */
 	public void thumbsUp(IssueConfig config) {
 		config.addCredentials(this);
@@ -814,6 +901,8 @@ public class SDKConnection {
 
 	/**
 	 * Thumbs down the content.
+	 *
+	 * @param config config
 	 */
 	public void thumbsDown(IssueConfig config) {
 		config.addCredentials(this);
@@ -822,6 +911,8 @@ public class SDKConnection {
 
 	/**
 	 * Rate the content.
+	 *
+	 * @param config config
 	 */
 	public void star(IssueConfig config) {
 		config.addCredentials(this);
@@ -830,14 +921,18 @@ public class SDKConnection {
 
 	/**
 	 * Flag the forum post as offensive, a reason is required.
+	 *
+	 * @param config config
 	 */
 	public void flag(IssueConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/flag-issue", config.toXML());
 	}
-	
+
 	/**
 	 * Flag the user post as offensive, a reason is required.
+	 *
+	 * @param config config
 	 */
 	public void flag(UserConfig config) {
 		config.addCredentials(this);
@@ -846,8 +941,9 @@ public class SDKConnection {
 	
 	/**
 	 * Process the bot chat message and return the bot's response.
-	 * The ChatConfig should contain the conversation id if part of a conversation.
-	 * If a new conversation the conversation id is returned in the response. 
+	 *
+	 * @param config config
+	 * @return Process the bot chat message and return the bot's response.
 	 */
 	public ChatResponse chat(ChatConfig config) {
 		config.addCredentials(this);
@@ -869,6 +965,9 @@ public class SDKConnection {
 	/**
 	 * Process the avatar message and return the avatars response.
 	 * This allows the speech and video animation for an avatar to be generated for the message.
+	 *
+	 * @param config config
+	 * @return avatarMessage
 	 */
 	public ChatResponse avatarMessage(AvatarMessage config) {
 		config.addCredentials(this);
@@ -886,18 +985,24 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Process the speech message and return the server generate text-to-speech audio file.
 	 * This allows for server-side speech generation.
+	 *
+	 * @param config config
+	 * @return tts
 	 */
 	public String tts(Speech config) {
 		config.addCredentials(this);
 		return POST(this.url + "/speak", config.toXML());
 	}
-	
+
 	/**
 	 * Return the administrators of the content.
+	 *
+	 * @param config config
+	 * @return Return the administrators of the content.
 	 */
 	public List<String> getAdmins(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -914,9 +1019,12 @@ public class SDKConnection {
 		}
 		return users;
 	}
-	
+
 	/**
 	 * Return the list of user details for the comma separated values list of user ids.
+	 *
+	 * @param usersCSV usersCSV
+	 * @return getUsers
 	 */
 	public List<UserConfig> getUsers(String usersCSV) {
 		UserConfig config = new UserConfig();
@@ -936,9 +1044,12 @@ public class SDKConnection {
 		}
 		return users;
 	}
-	
+
 	/**
 	 * Return the list of forum posts for the forum browse criteria.
+	 *
+	 * @param config config
+	 * @return Return the list of forum posts for the forum browse criteria.
 	 */
 	public List<ForumPostConfig> getPosts(BrowseConfig config) {
 		config.addCredentials(this);
@@ -958,6 +1069,9 @@ public class SDKConnection {
 
 	/**
 	 * Return the list of issues for the issue tracker browse criteria.
+	 *
+	 * @param config config
+	 * @return Return the list of issues for the issue tracker browse criteria.
 	 */
 	public List<IssueConfig> getIssues(BrowseConfig config) {
 		config.addCredentials(this);
@@ -974,9 +1088,12 @@ public class SDKConnection {
 		}
 		return instances;
 	}
-	
+
 	/**
 	 * Return the list of categories for the type, and domain.
+	 *
+	 * @param config config
+	 * @return Return the list of categories for the type, and domain.
 	 */
 	public List<ContentConfig> getCategories(ContentConfig config) {
 		config.addCredentials(this);
@@ -993,9 +1110,12 @@ public class SDKConnection {
 		}
 		return categories;
 	}
-	
+
 	/**
 	 * Return the list of tags for the type, and domain.
+	 *
+	 * @param config config
+	 * @return Return the list of tags for the type, and domain.
 	 */
 	public List<String> getTags(ContentConfig config) {
 		config.addCredentials(this);
@@ -1011,10 +1131,12 @@ public class SDKConnection {
 		}
 		return tags;
 	}
-	
+
 	/**
-	  * Return the list of bot templates.
-	  */
+	 * Return the list of bot templates.
+	 *
+	 * @return Return the list of bot templates.
+	 */
 	
 	//return the list of templates with the pictures.
 	 public List<InstanceConfig> getTemplates() {
@@ -1031,9 +1153,12 @@ public class SDKConnection {
 	  }
 	  return instances;
 	 }
-	
+
 	/**
 	 * Return the users for the content.
+	 *
+	 * @param config config
+	 * @return Return the users for the content.
 	 */
 	public List<String> getUsers(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -1050,9 +1175,12 @@ public class SDKConnection {
 		}
 		return users;
 	}
-	
+
 	/**
 	 * Return the channel's bot configuration.
+	 *
+	 * @param config config
+	 * @return Return the channel's bot configuration.
 	 */
 	public BotModeConfig getChannelBotMode(ChannelConfig config) {
 		config.addCredentials(this);
@@ -1070,73 +1198,84 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Save the channel's bot configuration.
+	 *
+	 * @param config config
 	 */
 	public void saveChannelBotMode(BotModeConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-channel-bot-mode", config.toXML());
 	}
-	
+
 	/**
 	 * Save the forum's bot configuration.
+	 *
+	 * @param config config
 	 */
 	public void saveForumBotMode(BotModeConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-forum-bot-mode", config.toXML());
 	}
-	
+
 	/**
 	 * Save the bot's learning configuration.
+	 *
+	 * @param config config
 	 */
 	public void saveLearning(LearningConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-learning", config.toXML());
 	}
-	
+
 	/**
 	 * Save the bot's voice configuration.
+	 *
+	 * @param config config
 	 */
 	public void saveVoice(VoiceConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-voice", config.toXML());
 	}
-	
+
 	/**
 	 * Save the bot's avatar configuration.
+	 *
+	 * @param config config
 	 */
 	public void saveBotAvatar(InstanceConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-bot-avatar", config.toXML());
 	}
-	
-	/**
-	 * Train the bot with a new question/response pair.
-	 */
-	public void train(TrainingConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/train-instance", config.toXML());
-	}
-	
+
+
 	/**
 	 * Perform the user administration task (add or remove users, or administrators).
+	 *
+	 * @param config config
 	 */
 	public void userAdmin(UserAdminConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/user-admin", config.toXML());
 	}
-	
+
 	/**
 	 * Save the image as the avatar's background.
+	 *
+	 * @param file file
+	 * @param config config
 	 */
 	public void saveAvatarBackground(String file, AvatarMedia config) {
 		config.addCredentials(this);
 		POSTIMAGE(this.url + "/save-avatar-background", file, config.name, config.toXML());
 	}
-	
+
 	/**
 	 * Add the avatar media file to the avatar.
+	 *
+	 * @param file file
+	 * @param config config
 	 */
 	public void createAvatarMedia(String file, AvatarMedia config) {
 		config.addCredentials(this);
@@ -1150,8 +1289,12 @@ public class SDKConnection {
 			POSTFILE(this.url + "/create-avatar-media", file, config.name, config.toXML());
 		}
 	}
+
 	/**
 	 * Add the graphic media file to the graphic.
+	 *
+	 * @param file file
+	 * @param config config
 	 */
 	public void createGraphicMedia(String file, GraphicConfig config) {
 		config.addCredentials(this);
@@ -1161,9 +1304,15 @@ public class SDKConnection {
 			POSTFILE(this.url + "/update-graphic-media", file, config.fileName, config.toXML());
 		}
 	}
+
 	/**
 	 * Update the contents icon.
 	 * The file will be uploaded to the server.
+	 *
+	 * @param file file
+	 * @param config config
+	 * @param <T> <T>
+	 * @return updateIcon
 	 */
 	@SuppressWarnings("unchecked")
 	public <T extends WebMediumConfig> T updateIcon(String file, T config) {
@@ -1182,10 +1331,13 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Update the user's icon.
-	 * The file will be uploaded to the server.
+	 *
+	 * @param file file
+	 * @param config config
+	 * @return Update the user's icon.
 	 */
 	public UserConfig updateIcon(String file, UserConfig config) {
 		config.addCredentials(this);
@@ -1203,7 +1355,16 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
+	/**
+	 * POSTIMAGE
+	 *
+	 * @param url url
+	 * @param file file
+	 * @param name name
+	 * @param xml xml
+	 * @return POSTIMAGE
+	 */
 	public String POSTIMAGE(String url, String file, String name, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1211,44 +1372,18 @@ public class SDKConnection {
 			System.out.println("XML: " + xml);
 		}
 		String result = "";
-//		try { //=====================
-//			Bitmap bitmap = loadImage(file, 600, 600);
-//	        ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//	        bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream);
-//	        byte[] byte_arr = stream.toByteArray();
-//	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-//
-//	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-//
-//	        multipartEntity.addPart("file", fileBody);
-//	        multipartEntity.addPart("xml", new StringBody(xml));
-//
-//	        HttpClient httpclient = new DefaultHttpClient();
-//	        HttpResponse response = null;
-//
-//            HttpPost httppost = new HttpPost(url);
-//            httppost.setEntity(multipartEntity);
-//            response = httpclient.execute(httppost);
-//
-//			HttpEntity entity = response.getEntity();
-//			if (entity != null) {
-//				result = EntityUtils.toString(entity, HTTP.UTF_8);
-//			}
-//
-//			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-//				this.exception = new SDKException(""
-//				   + response.getStatusLine().getStatusCode()
-//				   + " : " + result);
-//	 			throw this.exception;
-//			}
-//
-//        } catch (Exception exception) {
-// 			this.exception = new SDKException(exception);
-// 			throw this.exception;
-// 		}
  		return result;
 	}
 
+	/**
+	 * POSTIMAGE
+	 *
+	 * @param url url
+	 * @param bitmap bitmap
+	 * @param name name
+	 * @param xml xml
+	 * @return POSTIMAGE
+	 */
 	public String POSTIMAGE(String url, PixelMap bitmap, String name, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1257,7 +1392,6 @@ public class SDKConnection {
 		String result = "";
 		try {
 			ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//			bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream); //=====================
 			byte[] byte_arr = stream.toByteArray();
 			ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
 
@@ -1291,7 +1425,16 @@ public class SDKConnection {
 		}
 		return result;
 	}
-	
+
+	/**
+	 * POSTHDIMAGE
+	 *
+	 * @param url url
+	 * @param file file
+	 * @param name name
+	 * @param xml xml
+	 * @return POSTHDIMAGE
+	 */
 	public String POSTHDIMAGE(String url, String file, String name, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1299,44 +1442,18 @@ public class SDKConnection {
 			System.out.println("XML: " + xml);
 		}
 		String result = "";
-		try {
-//			Bitmap bitmap = loadImage(file, 600, 600);  //=====================
-//	        ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//	        bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream);
-//	        byte[] byte_arr = stream.toByteArray();
-//	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-//
-//	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-//
-//	        multipartEntity.addPart("file", fileBody);
-//	        multipartEntity.addPart("xml", new StringBody(xml));
-//
-//	        HttpClient httpclient = new DefaultHttpClient();
-//	        HttpResponse response = null;
-//
-//            HttpPost httppost = new HttpPost(url);
-//            httppost.setEntity(multipartEntity);
-//            response = httpclient.execute(httppost);
-//
-//			HttpEntity entity = response.getEntity();
-//			if (entity != null) {
-//				result = EntityUtils.toString(entity, HTTP.UTF_8);
-//			}
-//
-//			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-//				this.exception = new SDKException(""
-//				   + response.getStatusLine().getStatusCode()
-//				   + " : " + result);
-//	 			throw this.exception;
-//			}
-
-        } catch (Exception exception) {
- 			this.exception = new SDKException(exception);
- 			throw this.exception;
- 		}
  		return result;
 	}
-	
+
+	/**
+	 * POSTFILE
+	 *
+	 * @param url url
+	 * @param path path
+	 * @param name name
+	 * @param xml xml
+	 * @return POSTFILE
+	 */
 	public String POSTFILE(String url, String path, String name, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1388,35 +1505,11 @@ public class SDKConnection {
  		return result;
 	}
 
-	public PixelMap loadImage(String path, int reqWidth, int reqHeight) {
-//	    BitmapFactory.Options options = new BitmapFactory.Options(); //=====================
-//	    options.inJustDecodeBounds = true;
-//	    BitmapFactory.decodeFile(path, options);
-//
-//        int height = options.outHeight;
-//        int width = options.outWidth;
-//        options.inPreferredConfig = Bitmap.Config.RGB_565;
-//        int inSampleSize = 1;
-//
-//        if (height > reqHeight) {
-//            inSampleSize = Math.round((float)height / (float)reqHeight);
-//        }
-//
-//        int expectedWidth = width / inSampleSize;
-//
-//        if (expectedWidth > reqWidth) {
-//            inSampleSize = Math.round((float)width / (float)reqWidth);
-//        }
-//
-//	    options.inSampleSize = inSampleSize;
-//	    options.inJustDecodeBounds = false;
-//
-//	    return BitmapFactory.decodeFile(path, options);
-		return null;
-	 }
-	
 	/**
 	 * Return the forum's bot configuration.
+	 *
+	 * @param config config
+	 * @return Return the forum's bot configuration.
 	 */
 	public BotModeConfig getForumBotMode(ForumConfig config) {
 		config.addCredentials(this);
@@ -1434,9 +1527,12 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Return the bot's voice configuration.
+	 *
+	 * @param config config
+	 * @return Return the bot's voice configuration.
 	 */
 	public VoiceConfig getVoice(InstanceConfig config) {
 		config.addCredentials(this);
@@ -1454,9 +1550,12 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Return the bot's default responses.
+	 *
+	 * @param config config
+	 * @return Return the bot's default responses.
 	 */
 	public List<String> getDefaultResponses(InstanceConfig config) {
 		config.addCredentials(this);
@@ -1471,26 +1570,12 @@ public class SDKConnection {
 		}
 		return defaultResponses;
 	}
-	
-	/**
-	 * Return the bot's greetings.
-	 */
-	public List<String> getGreetings(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-greetings", config.toXML());
-		List<String> greetings = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return greetings;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			greetings.add(((Element)root.getChildNodes().item(index)).getChildNodes().item(0).getTextContent());
-		}
-		return greetings;
-	}
-	
+
 	/**
 	 * Search the bot's responses.
+	 *
+	 * @param config config
+	 * @return Search the bot's responses.
 	 */
 	public List<ResponseConfig> getResponses(ResponseSearchConfig config) {
 		config.addCredentials(this);
@@ -1507,9 +1592,12 @@ public class SDKConnection {
 		}
 		return responses;
 	}
-	
+
 	/**
 	 * Search the bot's conversations.
+	 *
+	 * @param config config
+	 * @return Search the bot's conversations.
 	 */
 	public List<ConversationConfig> getConversations(ResponseSearchConfig config) {
 		config.addCredentials(this);
@@ -1526,9 +1614,12 @@ public class SDKConnection {
 		}
 		return conversations;
 	}
-	
+
 	/**
 	 * Return the bot's learning configuration.
+	 *
+	 * @param config config
+	 * @return Return the bot's learning configuration.
 	 */
 	public LearningConfig getLearning(InstanceConfig config) {
 		config.addCredentials(this);
@@ -1546,10 +1637,14 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Return the list of content for the browse criteria.
 	 * The type defines the content type (one of Bot, Forum, Channel, Domain).
+	 *
+	 * @param ability ability
+	 * @param config config
+	 * @return browse
 	 */
 	public List<WebMediumConfig> browse(Ability ability,BrowseConfig config) {
 		config.addCredentials(this);
@@ -1587,9 +1682,12 @@ public class SDKConnection {
 		}
 		return instances;
 	}
-	
+
 	/**
 	 * Return the list of media for the avatar.
+	 *
+	 * @param config config
+	 * @return Return the list of media for the avatar.
 	 */
 	public List<AvatarMedia> getAvatarMedia(AvatarConfig config) {
 		config.addCredentials(this);
@@ -1606,9 +1704,12 @@ public class SDKConnection {
 		}
 		return instances;
 	}
-	
+
 	/**
 	 * Return the script source
+	 *
+	 * @param config config
+	 * @return Return the script source
 	 */
 	public ScriptSourceConfig getScriptSource(ScriptConfig config) {
 		config.addCredentials(this);
@@ -1626,17 +1727,22 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Create or update script - Save the script source
+	 *
+	 * @param config config
 	 */
 	public void saveScriptSource(ScriptSourceConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-script-source", config.toXML());
 	}
-	
+
 	/**
 	 * Return the source code for a single bot script
+	 *
+	 * @param config config
+	 * @return Return the source code for a single bot script
 	 */
 	public ScriptSourceConfig getBotScriptSource(ScriptSourceConfig config) {
 		config.addCredentials(this);
@@ -1654,9 +1760,12 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
 	/**
 	 * Return a list of the bots scripts
+	 *
+	 * @param config config
+	 * @return Return a list of the bots scripts
 	 */
 	public List<ScriptConfig> getBotScripts(InstanceConfig config) {
 		config.addCredentials(this);
@@ -1673,123 +1782,118 @@ public class SDKConnection {
 		}
 		return botScripts;
 	}
+
 	/**
 	 * import a script to the bot
+	 *
+	 * @param config config
 	 */
 	
 	public void importBotScript(ScriptConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/import-bot-script", config.toXML());
 	}
-	
+
 	/**
 	 * import a chatlog/response list to the bot
+	 *
+	 * @param config config
 	 */
 	public void importBotLog(ScriptConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/import-bot-log", config.toXML());
 	}
-	
-	
+
+
 	/**
 	 * Save the bot script source
+	 *
+	 * @param config config
 	 */
 	public void saveBotScriptSource(ScriptSourceConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-bot-script-source", config.toXML());
 	}
-	
+
 	/**
 	 * Delete selected bot script
+	 *
+	 * @param config config
 	 */
 	public void deleteBotScript(ScriptSourceConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/delete-bot-script", config.toXML());
 	}
-	
+
 	/**
 	 * Move up one bot script
+	 *
+	 * @param config config
 	 */
 	public void upBotScript(ScriptSourceConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/up-bot-script", config.toXML());
 	}
-	
+
 	/**
 	 * Move down one bot script
+	 *
+	 * @param config config
 	 */
 	public void downBotScript(ScriptSourceConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/down-bot-script", config.toXML());
 	}
-	
+
 	/**
 	 * Return the list of content types.
+	 *
+	 * @return Return the list of content types.
 	 */
 	public String[] getTypes() {
 		return types;
 	}
-	
-	/**
-	 * Return the channel types.
-	 */
-	public String[] getChannelTypes() {
-		return channelTypes;
-	}
-	
+
 	/**
 	 * Return the access mode types.
+	 *
+	 * @return Return the access mode types.
 	 */
 	public String[] getAccessModes() {
 		return accessModes;
 	}
-	
+
 	/**
 	 * Return the media access mode types.
+	 *
+	 * @return Return the media access mode types.
 	 */
 	public String[] getMediaAccessModes() {
 		return mediaAccessModes;
 	}
-	
-	/**
-	 * Return the learning mode types.
-	 */
-	public String[] getLearningModes() {
-		return learningModes;
-	}
-	
-	/**
-	 * Return the correction mode types.
-	 */
-	public String[] getCorrectionModes() {
-		return correctionModes;
-	}
-	
-	/**
-	 * Return the bot mode types.
-	 */
-	public String[] getBotModes() {
-		return botModes;
-	}
-	
+
 	/**
 	 * Return the current connected user.
+	 *
+	 * @return Return the current connected user.
 	 */
 	public UserConfig getUser() {
 		return user;
 	}
-	
+
 	/**
 	 * Set the current connected user.
-	 * connect() should be used to validate and connect a user.
+	 *
+	 * @param user
 	 */
 	public void setUser(UserConfig user) {
 		this.user = user;
 	}
-	
+
 	/**
 	 * Return the current domain.
-	 * A domain is an isolated content space.
+	 *
+	 * @return Return the current domain.
 	 */
 	public DomainConfig getDomain() {
 		return domain;
@@ -1797,44 +1901,45 @@ public class SDKConnection {
 	
 	/**
 	 * Set the current domain.
-	 * A domain is an isolated content space.
-	 * connect() should be used to validate and connect a domain.
+	 *
+	 * @param domain domain
 	 */
 	public void setDomain(DomainConfig domain) {
 		this.domain = domain;
 	}
-	
+
 	/**
 	 * Return the current application credentials.
+	 *
+	 * @return getCredentials
 	 */
 	public Credentials getCredentials() {
 		return credentials;
 	}
-	
+
 	/**
 	 * Set the application credentials.
+	 *
+	 * @param credentials credentials
 	 */
 	public void setCredentials(Credentials credentials) {
 		this.credentials = credentials;
 		this.url = credentials.url;
 	}
-	
-	/**
-	 * Return is debugging has been enabled.
-	 */
-	public boolean isDebug() {
-		return debug;
-	}
-	
+
 	/**
 	 * Enable debugging, debug messages will be logged to System.out.
+	 *
+	 * @param debug debug
 	 */
 	public void setDebug(boolean debug) {
 		this.debug = debug;
 	}
-	
+
 	/**
 	 * Return the last thrown exception.
+	 *
+	 * @return Return the last thrown exception.
 	 */
 	public SDKException getException() {
 		return exception;
@@ -1844,6 +1949,12 @@ public class SDKConnection {
 		this.exception = exception;
 	}
 
+	/**
+	 * GET
+	 *
+	 * @param url url
+	 * @return GET string
+	 */
 	public String GET(String url) {
 		if (this.debug) {
 			System.out.println("GET: " + url);
@@ -1873,6 +1984,13 @@ public class SDKConnection {
 		return xml;
 	}
 
+	/**
+	 * POST
+	 *
+	 * @param url url
+	 * @param xml xml
+	 * @return POST
+	 */
 	public String POST(String url, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1910,6 +2028,14 @@ public class SDKConnection {
 		return result;
 	}
 
+	/**
+	 * POSTUpdate
+	 *
+	 * @param ability ability
+	 * @param url url
+	 * @param xml xml
+	 * @return POSTUpdate
+	 */
 	public String POSTUpdate(Ability ability,String url, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1940,10 +2066,12 @@ public class SDKConnection {
 	}
 
 	/**
-	 * This method is used to get cookies from response
+	 * getResponse
 	 *
-	 * @param client OkHttpClient to get cookies from response
-	 * @param url Http URL
+	 * @param client client
+	 * @param url url
+	 * @param xml xml
+	 * @return getResponse
 	 */
 	public Response getResponse(OkHttpClient client, String url, String xml) {
 		// code request code here
@@ -1960,46 +2088,19 @@ public class SDKConnection {
 		} catch (IOException e) {
 			e.printStackTrace();
 		}
-//		call.enqueue(new Callback() {
-//			@Override
-//			public void onFailure(Call call, IOException exception) {
-//			}
-//
-//			@Override
-//			public void onResponse(Call call, Response response) {
-//				if (response != null && response.body() != null) {
-//					List<String> cookieList = response.headers("Set-Cookie");
-//					StringBuilder stringBuilder = new StringBuilder();
-//					if (cookieList.size() > 0) {
-//						for (String cookie : cookieList) {
-//							stringBuilder.append(cookie).append(",");
-//						}
-//					}
-//					content[0] = response.body().toString();
-//				}
-//			}
-//		});
 		return null;
 	}
-	
+
+	/**
+	 * parse
+	 *
+	 * @param xml xml
+	 * @return parse
+	 */
 	public Element parse(String xml) {
 		if (this.debug) {
 			System.out.println(xml);
 		}
-		Document dom = null;
-		DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance();
-		try {
-			DocumentBuilder builder = factory.newDocumentBuilder();
-			InputSource source = new InputSource();
-			source.setCharacterStream(new StringReader(xml));
-			dom = builder.parse(source);
-			return dom.getDocumentElement();
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-			this.exception = new SDKException(exception.getMessage(), exception);
-			throw this.exception;
-		}
+		return (Element) new ShapeElement();
 	}
 }
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/BaseAbility.java
similarity index 85%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/BaseAbility.java
index 974e7041f5a8b8f9d1120d99d79dfbaa4907e0b4..c659c6a66288d1f3dd8b6623b662c74d8d26148d 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/BaseAbility.java
@@ -1,4 +1,4 @@
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
index fb325e52b0c6a6ae7a3240f806bb52ed2b3d1067..a113dbe2de311c50161407295b3e6911e3a34f63 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
@@ -16,9 +16,9 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Text;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
similarity index 79%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
index 3b9c8fa624a2b0a01f689edde6dc3cb2081bdd49..102e0e7bcb8517574e4939f7de5ca61d30645592 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
@@ -16,11 +16,11 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.*;
+import org.botlibre.sdk.ability.actions.*;
 import org.botlibre.sdk.config.*;
 import org.botlibre.sdk.provider.ChatListProvicer;
 import org.botlibre.sdk.util.*;
@@ -339,7 +339,7 @@ public class ChatAbility extends LibreAbility {
         @Override
         public void onError(int error) {
             debug("onError:" + error);
-            LogUtils.sop("ChatActivity on error executes here!");
+            LogUtils.sop(" on error executes here!");
             try {
                 isRecording = false;
 
@@ -431,15 +431,7 @@ public class ChatAbility extends LibreAbility {
     protected void onStart(Intent intent) {
         super.onStart(intent);
         LogUtils.sop("进入ChatAbility");
-//        if (MainAbility.current == null) {
-//            terminateAbility();
-//            return;
-//        }
-//        if (MainAbility.instance == null || !(MainAbility.instance instanceof InstanceConfig)) {
-//            terminateAbility();
-//            return;
-//        }
-        super.setUIContent(ResourceTable.Layout_activity_chat);
+        super.setUIContent(ResourceTable.Layout_ability_chat);
         ability = this;
         //clear the messages from the listView -
         messages.clear();
@@ -451,15 +443,10 @@ public class ChatAbility extends LibreAbility {
         micLastStat = MainAbility.listenInBackground;
         getWindow().addFlags(WindowManager.LayoutConfig.MARK_SCREEN_ON_ALWAYS);
 
-        //this.instance = (InstanceConfig) MainAbility.instance;
-
         tvTitle = ((Text) findComponentById(ResourceTable.Id_title));
         imAvatar = (Image) findComponentById(ResourceTable.Id_icon);
         tvTitle.setText("Pizza Bot");
         imAvatar.setPixelMap(ResourceTable.Media_bot);
-//        if (MainAbility.online) {
-//            HttpGetImageAction.fetchImage(this, this.instance.avatar, (Image) findComponentById(ResourceTable.Id_icon));
-//        }
         ttsClient = TtsClient.getInstance();
         ttsClient.create(this, ttsListener);
 
@@ -544,18 +531,6 @@ public class ChatAbility extends LibreAbility {
                     microphoneThread(thread);
                     stopListening();
                 }
-            } else {
-//                Intent intent = new Intent(RecognizerIntent.ACTION_RECOGNIZE_SPEECH);
-//                intent.putExtra(RecognizerIntent.EXTRA_LANGUAGE_MODEL, MainAbility.voice.language);
-//                try {
-//                    startAbilityForResult(intent, RESULT_SPEECH);
-//                    textView.setText("");
-//                } catch (AbilityNotFoundException exception) {
-//                    Toast toast = Toast.makeText(getApplicationContext(),
-//                            "Your device doesn't support Speech to Text",
-//                            Toast.LENGTH_SHORT);
-//                    toast.show();
-//                }
             }
         });
 
@@ -669,16 +644,6 @@ public class ChatAbility extends LibreAbility {
             }
         });
 
-        if (!MainAbility.online) {
-            HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, this.bigImage);
-            HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, (Image) findComponentById(ResourceTable.Id_responseImageView));
-            HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, findComponentById(ResourceTable.Id_icon));
-        } else {
-            //HttpGetImageAction.fetchImage(this, this.instance.avatar, imAvatar);
-            //HttpGetImageAction.fetchImage(this, instance.avatar, this.bigImage);
-            //HttpGetImageAction.fetchImage(this, instance.avatar, (Image) findComponentById(ResourceTable.Id_responseImageView));
-        }
-
         final ChatConfig config = new ChatConfig();
         //config.instance = instance.id;
         config.avatar = this.avatarId;
@@ -724,7 +689,7 @@ public class ChatAbility extends LibreAbility {
             threadIsOn = false;
             active = false;
             try {
-                thread.stop();
+                thread.interrupt();
             } catch (Exception ignore) {
             }
             return thread;
@@ -834,24 +799,8 @@ public class ChatAbility extends LibreAbility {
         menuComponent.findComponentById(ResourceTable.Id_menuItem6).setClickedListener(listener);
         menuComponent.findComponentById(ResourceTable.Id_menuItem7).setClickedListener(listener);
 
-//        Checkbox checkBox1 = (Checkbox) menuComponent.findComponentById(ResourceTable.Id_checkBox1);
-//        Checkbox checkBox2 = (Checkbox) menuComponent.findComponentById(ResourceTable.Id_checkBox2);
-//        Checkbox checkBox3 = (Checkbox) menuComponent.findComponentById(ResourceTable.Id_checkBox3);
-//        Checkbox checkBox4 = (Checkbox) menuComponent.findComponentById(ResourceTable.Id_checkBox4);
-//        Checkbox checkBox5 = (Checkbox) menuComponent.findComponentById(ResourceTable.Id_checkBox5);
-//        Checkbox checkBox6 = (Checkbox) menuComponent.findComponentById(ResourceTable.Id_checkBox6);
-//        Checkbox checkBox7 = (Checkbox) menuComponent.findComponentById(ResourceTable.Id_checkBox7);
-//        setCheckBoxShape(checkBox1, checkBox2, checkBox3, checkBox4, checkBox5, checkBox6);
         menuDialog.setAlignment(LayoutAlignment.LEFT | LayoutAlignment.BOTTOM);
         menuDialog.show();
-//        statistics.setClickedListener(new Component.ClickedListener() {
-//            @Override
-//            public void onClick(Component component) {
-//
-//                menuDialog.hide();
-//                menuDialog.remove();
-//            }
-//        });
     }
 
     private void setCheckBoxShape(Checkbox... checkBoxs) {
@@ -864,14 +813,6 @@ public class ChatAbility extends LibreAbility {
     }
 
     public void resetVideoErrorListener() {
-//        videoView.setOnErrorListener(new OnErrorListener() {
-//            @Override
-//            public boolean onError(MediaPlayer mp, int what, int extra) {
-//                Log.wtf("Video error", "what:" + what + " extra:" + extra);
-//                videoError = true;
-//                return true;
-//            }
-//        });
     }
 
     @Override
@@ -880,51 +821,9 @@ public class ChatAbility extends LibreAbility {
 
         switch (requestCode) {
             case CAPTURE_IMAGE: {
-
-//                if (resultCode == RESULT_OK) {
-//                    //TODO Make camera intent stop app from reseting
-//                    //Uri photoUri = data.getData();
-//                    //Do what we like with the photo - send to bot, etc
-//
-//                } else if (resultCode == RESULT_CANCELED) {
-//                    textView.setText("Cancelled");
-//                    submitChat();
-//                }
-
-                break;
-            }
-            case CAPTURE_VIDEO: {
-//                if (resultCode == RESULT_OK) {
-//                    Uri videoUri = data.getData();
-//                    //Do what we would like with the video
-//
-//                } else if (resultCode == RESULT_CANCELED) {
-//                    textView.setText("Cancelled");
-//                    submitChat();
-//                }
-                break;
-            }
-            case RESULT_SPEECH: {
-//                if (resultCode == RESULT_OK && data != null) {
-//
-//                    ArrayList<String> text = data.getStringArrayListParam(RecognizerIntent.EXTRA_RESULTS);
-//
-//
-//                    textView.setText(text.get(0));
-//                    submitChat();
-//                }
                 break;
             }
         }
-//        IntentResult scanResult = IntentIntegrator.parseAbilityResult(requestCode, resultCode, data);
-//        if (scanResult != null) {
-//            textView.setText("lookup " + scanResult.getContents());
-//            submitChat();
-//            if (scanResult.getContents().startsWith("http")) {
-//                Intent intent = new Intent(Intent.ACTION_VIEW, Uri.parse(scanResult.getContents()));
-//                startAbility(intent);
-//            }
-//        }
     }
 
     public void flagResponse() {
@@ -974,11 +873,8 @@ public class ChatAbility extends LibreAbility {
     public void submitCorrection() {
         final TextField text = new TextField(this);
         MainAbility.prompt("Enter correction to the bot's response (what it should have said)", this, text, (iDialog, i) -> {
-//            if (instance == null) {
-//                return;
-//            }
             ChatConfig config = new ChatConfig();
-            //config.instance = instance.id;
+            // config.instance = instance.id;
             config.conversation = MainAbility.conversation;
             config.speak = !MainAbility.deviceVoice;
             config.avatar = avatarId;
@@ -1000,15 +896,6 @@ public class ChatAbility extends LibreAbility {
 
             config.correction = true;
 
-//            Spinner emoteSpin = (Spinner) findViewById(R.id.emoteSpin);
-//            config.emote = emoteSpin.getSelectedItem().toString();
-//
-//            HttpChatAction action = new HttpChatAction(ChatAbility.this, config);
-//            action.execute();
-//
-//            TextField v = (TextField) findComponentById(ResourceTable.Id_messageText);
-//            v.setText("");
-//            emoteSpin.setSelection(0);
             resetToolbar();
 
             webView.load(null, "thinking...", "text/html", "utf-8", null);
@@ -1169,7 +1056,7 @@ public class ChatAbility extends LibreAbility {
                 this.videoLayout.setVisibility(Component.HIDE);
             }
 
-            HttpGetImageAction.fetchImage(this, this.avatar.avatar, this.bigImage);
+//            HttpGetImageAction.fetchImage(this, this.avatar.avatar, this.bigImage);
 
             AvatarConfig avatarConfig = (AvatarConfig) this.avatar.credentials();
             HttpFetchChatAvatarAction action = new HttpFetchChatAvatarAction(this, avatarConfig);
@@ -1206,8 +1093,8 @@ public class ChatAbility extends LibreAbility {
     }
 
     public void resetAvatar(AvatarConfig config) {
-        HttpGetImageAction.fetchImage(this, config.avatar, this.bigImage);
-        HttpGetImageAction.fetchImage(this, config.avatar, (Image) findComponentById(ResourceTable.Id_responseImageView));
+//        HttpGetImageAction.fetchImage(this, config.avatar, this.bigImage);
+//        HttpGetImageAction.fetchImage(this, config.avatar, (Image) findComponentById(ResourceTable.Id_responseImageView));
     }
 
     public void MicConfiguration() {
@@ -1278,6 +1165,9 @@ public class ChatAbility extends LibreAbility {
 
     /**
      * Add JavaScript to the HTML to raise postback events to send messages to the bot.
+     *
+     * @param html html
+     * @return String html
      */
     public String linkPostbacks(String html) {
         if (html.contains("button")) {
@@ -1369,19 +1259,11 @@ public class ChatAbility extends LibreAbility {
 
             final String text = response.message;
             if (text == null) {
-                //listContainer.invalidateViews();
-//                if (listContainer.getChildCount() > 2) {
-//                    listContainer.setSelection(list.getCount() - 2);
-//                }
                 beginListening();
                 return;
             }
             messages.add(response);
             listContainer.getItemProvider().notifyDataChanged();
-//            listContainer.invalidateViews();
-//            if (listContainer.getCount() > 2) {
-//                listContainer.setSelection(list.getCount() - 2);
-//            }
 
             String html = Utils.linkHTML(text);
             if (stateLayouts == 3 || stateLayouts == 4) {
@@ -1395,76 +1277,10 @@ public class ChatAbility extends LibreAbility {
             boolean talk = (text.trim().length() > 0) && (MainAbility.deviceVoice || (this.response.speech != null && this.response.speech.length() > 0));
             if (MainAbility.sound && talk) {
                 if (!MainAbility.disableVideo && !videoError && this.response.isVideo() && this.response.isVideoTalk()) {
-
-//                    videoView.setOnPreparedListener(new OnPreparedListener() {
-//                        @Override
-//                        public void onPrepared(MediaPlayer mp) {
-//                            try {
-//                                mp.setLooping(true);
-//                                if (!MainAbility.deviceVoice) {
-//                                    // Voice audio
-//                                    if (MainAbility.online) {
-//                                        speechPlayer = playAudio(response.speech, false, false, false);
-//                                        speechPlayer.setOnCompletionListener(new OnCompletionListener() {
-//                                            @Override
-//                                            public void onCompletion(MediaPlayer mp) {
-//                                                mp.release();
-//                                                videoView.post(new Runnable() {
-//                                                    public void run() {
-//                                                        cycleVideo(response);
-//                                                    }
-//                                                });
-//                                                runOnUiThread(new Runnable() {
-//                                                    public void run() {
-//                                                        if (!music) {
-//                                                            beginListening();
-//                                                        }
-//                                                    }
-//                                                });
-//                                            }
-//                                        });
-//
-//                                        speechPlayer.play();
-//                                    }
-//                                } else {
-//                                    HashMap<String, String> params = new HashMap<String, String>();
-//                                    params.put(TextToSpeech.Engine.KEY_PARAM_UTTERANCE_ID, "id");
-//
-//                                    tts.speakText(Utils.stripTags(text), TextToSpeech.QUEUE_FLUSH, params);
-//                                }
-//                            } catch (Exception exception) {
-//                                LogUtils.sop(exception.getMessage());
-//                            }
-//                        }
-//                    });
                     playVideo(this.response.avatarTalk, false);
                 } else if (talk) {
-//                    if (!MainAbility.deviceVoice) {
-//                        // Voice audio
-//                        if (MainAbility.online) {
-//                            playAudio(this.response.speech, false, false, true);
-//                        }
-//                    } else {
-//                        HashMap<String, String> params = new HashMap<String, String>();
-//                        params.put(TextToSpeech.Engine.KEY_PARAM_UTTERANCE_ID, "id");
-//
-//                        this.tts.speakText(Utils.stripTags(text), TextToSpeech.QUEUE_FLUSH, params);
-//                    }
                 }
             } else if (talk && (!MainAbility.disableVideo && !videoError && this.response.isVideo() && this.response.avatarTalk != null)) {
-//                videoView.setOnPreparedListener(new OnPreparedListener() {
-//                    @Override
-//                    public void onPrepared(MediaPlayer mp) {
-//                        mp.setLooping(false);
-//                    }
-//                });
-//                videoView.setOnCompletionListener(new OnCompletionListener() {
-//                    @Override
-//                    public void onCompletion(MediaPlayer mp) {
-//                        videoView.setOnCompletionListener(null);
-//                        cycleVideo(response);
-//                    }
-//                });
                 playVideo(this.response.avatarTalk, false);
                 handler.sendEvent(BEGIN_LISTENING);
 
@@ -1488,84 +1304,15 @@ public class ChatAbility extends LibreAbility {
 
 
     public void playVideo(String video, boolean loop) {
-//        if (loop) {
-//            videoView.setOnPreparedListener(new OnPreparedListener() {
-//                @Override
-//                public void onPrepared(MediaPlayer mp) {
-//                    mp.setLooping(true);
-//                }
-//            });
-//        }
-//        try {
-//            Uri videoUri = HttpGetVideoAction.fetchVideo(this, video);
-//            if (videoUri == null) {
-//                if (MainAbility.online) {
-//                    videoUri = Uri.parse(MainAbility.connection.fetchImage(video).toURI().toString());
-//                }
-//            }
-//            videoView.setVideoURI(videoUri);
-//            videoView.start();
-//        } catch (Exception exception) {
-//            Log.wtf(exception.toString(), exception);
-//        }
     }
 
     public void cycleVideo(final ChatResponse response) {
-//        if ((response.avatar2 == null || response.avatar3 == null || response.avatar4 == null || response.avatar5 == null)
-//                || (response.avatar2.isEmpty() || response.avatar3.isEmpty() || response.avatar4.isEmpty() || response.avatar5.isEmpty())
-//                || (response.avatar.equals(response.avatar2) && response.avatar2.equals(response.avatar3)
-//                && response.avatar3.equals(response.avatar4) && response.avatar4.equals(response.avatar5))) {
-//            playVideo(response.avatar, true);
-//            return;
-//        }
-//        videoView.setOnPreparedListener(new OnPreparedListener() {
-//            @Override
-//            public void onPrepared(MediaPlayer mp) {
-//                mp.setLooping(false);
-//            }
-//        });
-//        videoView.setOnCompletionListener(new OnCompletionListener() {
-//            @Override
-//            public void onCompletion(MediaPlayer mp) {
-//                cycleVideo(response);
-//            }
-//        });
-//        int value = random.nextInt(5);
-//        String avatar = response.avatar;
-//        switch (value) {
-//            case 1:
-//                avatar = response.avatar2;
-//                break;
-//            case 2:
-//                avatar = response.avatar3;
-//                break;
-//            case 3:
-//                avatar = response.avatar5;
-//                break;
-//            case 14:
-//                avatar = response.avatar4;
-//                break;
-//        }
-//
-//        try {
-//            Uri videoUri = HttpGetVideoAction.fetchVideo(this, avatar);
-//            if (videoUri == null) {
-//                if (MainAbility.online) {
-//                    videoUri = Uri.parse(MainAbility.connection.fetchImage(avatar).toURI().toString());
-//                }
-//            }
-//            videoView.setVideoURI(videoUri);
-//            videoView.start();
-//        } catch (Exception exception) {
-//            LogUtils.sop(exception.toString());
-//        }
     }
 
     public Player playAudio(String audio, boolean loop, boolean cache, boolean start) {
         try {
             Uri audioUri = null;
             if (cache) {
-                audioUri = HttpGetVideoAction.fetchVideo(this, audio);
             }
             if (audioUri == null) {
                 audioUri = Uri.parse(MainAbility.connection.fetchImage(audio).toURI().toString());
@@ -1700,8 +1447,6 @@ public class ChatAbility extends LibreAbility {
     }
 
     public void scanBarcode(Component v) {
-//        IntentIntegrator integrator = new IntentIntegrator(this);
-//        integrator.initiateScan();
     }
 
     private void setMicIcon(boolean on, boolean recording) {
@@ -1727,10 +1472,6 @@ public class ChatAbility extends LibreAbility {
         ready.message = text;
         messages.add(ready);
         listContainer.getItemProvider().notifyDataChanged();
-//                listContainer.invalidateViews();
-//                if (listContainer.getCount() > 2) {
-//                    listContainer.setSelection(list.getCount() - 2);
-//                }
     }
 
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
index 0fbafdfde93430b234ed7a2b82d0ce7d4ae7cd58..a27cd18b1299f79d087d4d640da74ea508ca3cc2 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
@@ -16,10 +16,10 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpCreateUserAction;
+import org.botlibre.sdk.ability.actions.HttpCreateUserAction;
 import org.botlibre.sdk.config.UserConfig;
 import org.botlibre.sdk.util.ResUtil;
 import ohos.aafwk.content.Intent;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
index 867233c8dcd3a0c90f17c57333ca6f8f7c46862f..6482acb8bedd2ecf15941cb13b60b6e39e441ea2 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 /**
  * A convenience enum of different emotional states.
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
similarity index 95%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
index 4d34816546b125835bef140d490e966018b9d0c5..3fe761758467de39c6a7641b848c68d56e6431c3 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
@@ -16,13 +16,13 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpFetchAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.actions.HttpResultAction;
+import org.botlibre.sdk.ability.actions.HttpFetchAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.actions.HttpResultAction;
 import org.botlibre.sdk.config.BrowseConfig;
 import org.botlibre.sdk.config.ChannelConfig;
 import org.botlibre.sdk.config.ForumConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/IntentResult.java
similarity index 91%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/IntentResult.java
index 5f5641ed1e2840598e5a9a3eafebf5d774d5bb18..84975dbe742d15b6742aab0aff97996b998f9bd2 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/IntentResult.java
@@ -14,7 +14,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 /**
  * <p>Encapsulates the result of a barcode scan invoked through {@link IntentIntegrator}.</p>
@@ -47,6 +47,8 @@ public final class IntentResult {
 
   /**
    * @return raw content of barcode
+   *
+   * @return getContents
    */
   public String getContents() {
     return contents;
@@ -54,6 +56,8 @@ public final class IntentResult {
 
   /**
    * @return name of format, like "QR_CODE", "UPC_A". See {@code BarcodeFormat} for more format names.
+   *
+   * @return getFormatName
    */
   public String getFormatName() {
     return formatName;
@@ -61,6 +65,8 @@ public final class IntentResult {
 
   /**
    * @return raw bytes of the barcode content, if applicable, or null otherwise
+   *
+   * @return getRawBytes
    */
   public byte[] getRawBytes() {
     return rawBytes;
@@ -68,6 +74,8 @@ public final class IntentResult {
 
   /**
    * @return rotation of the image, in degrees, which resulted in a successful scan. May be null.
+   *
+   * @return getOrientation
    */
   public Integer getOrientation() {
     return orientation;
@@ -75,11 +83,18 @@ public final class IntentResult {
 
   /**
    * @return name of the error correction level used in the barcode, if applicable
+   *
+   * @return getErrorCorrectionLevel
    */
   public String getErrorCorrectionLevel() {
     return errorCorrectionLevel;
   }
-  
+
+  /**
+   * toString
+   *
+   * @return toString
+   */
   @Override
   public String toString() {
     StringBuilder dialogText = new StringBuilder(100);
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
similarity index 85%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
index 3f4a3e6c2b1004a047aecd33c9cd7dc848067756..cc2503cb58a20a10f3880a5fab22de148bdac1e0 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
@@ -28,18 +28,14 @@ import ohos.aafwk.content.Operation;
 public abstract class LibreAbility extends Ability {
 
 	public void help() {
-//		Intent intent = new Intent();
-//		Operation operation = new Intent.OperationBuilder()
-//				.withDeviceId("")
-//				.withBundleName(this.getBundleName())
-//				.withAbilityName(HelpAbility.class.getName())
-//				.build();
-//		intent.setOperation(operation);
-//		startAbility(intent);
+
 	}
 
 	/**
-	 * 启动activity
+	 * 启动ability
+	 *
+	 * @param ability ability
+	 * @param name name
 	 */
 	public void startOpenAbility(Ability ability,String name){
 		Intent intent = new Intent();
@@ -53,7 +49,12 @@ public abstract class LibreAbility extends Ability {
 	}
 
 	/**
-	 * 启动activity
+	 * 启动ability
+	 *
+	 * @param ability ability
+	 * @param name name
+	 * @param key key
+	 * @param param param
 	 */
 	public void startOpenAbility(Ability ability,String name,String key,String param){
 		Intent intent = new Intent();
@@ -69,6 +70,10 @@ public abstract class LibreAbility extends Ability {
 
 	/**
 	 * getIntent
+	 *
+	 * @param ability ability
+	 * @param name name
+	 * @return getIntent
 	 */
 	public Intent getIntent(Ability ability, String name) {
 		Intent intent = new Intent();
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ListTagAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ListTagAbility.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ListTagAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ListTagAbility.java
index e814749e036ef2314b2198511bbc2de5f1d50960..2e63481df90ce4d100c1796fc34d733d0c10213c 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ListTagAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ListTagAbility.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.ResourceTable;
 import ohos.aafwk.content.Intent;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
similarity index 99%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
index ea8b83bcee1072d56b1f90f0b2ad9d0c30db6b2c..8a30f5710b4f81b71b087f51bfbd8ddbc3784d12 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
@@ -15,7 +15,7 @@
  *  limitations under the License.
  *
  ******************************************************************************/
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import java.util.ArrayList;
 import java.util.List;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
index 3185099d6ec5187c8bb6e00699b21b68a700fb6c..33443529161e668bbe4b0c7cd5cdf6fbe1282b9d 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
@@ -16,10 +16,10 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpConnectAction;
+import org.botlibre.sdk.ability.actions.HttpConnectAction;
 import org.botlibre.sdk.config.UserConfig;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
index 99b1d2a3d0ec4e8759fa553873d2b51c09474f04..53b5eb2bedcaa0b5c52d97a08a6c3849d8f5e81e 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
@@ -16,14 +16,14 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpBrowseCategoriesAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.dialog.SearchDialogBuilder;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.actions.HttpBrowseCategoriesAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.dialog.SearchDialogBuilder;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.config.BrowseConfig;
 import org.botlibre.sdk.util.PreferencesUtils;
 import org.botlibre.sdk.util.ResUtil;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
similarity index 91%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
index 4b4c8bac5aa4055ca9f9fb3037aa2f396a5028f8..684bfb07544698f1546c89819d18a192d0aec04f 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.util.AsyncTask;
 import ohos.aafwk.ability.Ability;
@@ -40,7 +40,10 @@ public abstract class HttpAction extends AsyncTask<Void, Void, String> {
     }
 
     /**
-     * 启动activity
+     * 启动ability
+     *
+     * @param ability ability
+     * @param name name
      */
     public void startOpenAbility(Ability ability, String name) {
         Intent intent = new Intent();
@@ -65,7 +68,11 @@ public abstract class HttpAction extends AsyncTask<Void, Void, String> {
     }
 
     /**
-     * 启动activity
+     * 启动ability
+     *
+     * @param ability ability
+     * @param name name
+     * @param requestCode requestCode
      */
     public void startOpenAbilityForResult(Ability ability, String name, int requestCode) {
         Intent intent = new Intent();
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAddAvatarMediaAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAddAvatarMediaAction.java
index c83873af7985cd5cf6ac35ddc8fb4e46e5fb47e3..e0bd534a7d4f157665a028ecc4c3a55db39d99e4 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAddAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAvatarMessageAction.java
similarity index 99%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAvatarMessageAction.java
index 448e34a0de096fde5991bacc9a4c66d3d0700d83..116f84d7f4eea5164aebb62da52a1105b6c571e2 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAvatarMessageAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpBrowseCategoriesAction.java
similarity index 99%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpBrowseCategoriesAction.java
index 152e8a24ad71348b0b977d1ba08be986da5c9a00..5882f9dc42fb074c2d7ee44c57caf44f0185ed9b 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpBrowseCategoriesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import ohos.aafwk.ability.Ability;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeIconAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeIconAction.java
index ea62e54ec97744105480b532ddb5cfd1f8edcec2..bd6514f4d8a4b49aedd544e35b3cbc674dc4b5e4 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeIconAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeUserIconAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeUserIconAction.java
index d1896c134c2a1f85081b043a0f55f36604a89ba6..3639e3c93c4ebe8789200490ea3c2cdb330d1602 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeUserIconAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChatAction.java
similarity index 99%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChatAction.java
index b25925b039326e4a8be5960200c3a1a1887613b5..f74982ea2616e4eb7e4b5bd1f78e9fe4291119ef 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChatAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
similarity index 98%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
index 1b518dcc54796500362c502bf60ceaae5438362c..dd3efc61703b320507273886cd2cc06efa6ad289 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
similarity index 98%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
index cd19265d3126450c04e4f83cffc38a7261debd9a..07ab9d620cf25e2d854134a7a68e484704c519c4 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
index 075e27d04afc91bdaa00e48dae011b509fef58bc..10d8ba353dc581e6ba82f998e130cd3b97c8d051 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
index cf874a13752d47400679af080a94b9ccd29a08cd..52f21351d8c71453369dfb422041544acca447df 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
index c452ff0f9df95e9f895e81ad192ed7213492f4f7..6bdb577e7ef3ded32caed03bd1ff0cce17e63d9a 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueAction.java
index 4893832d1dcc10063bf074880eb26b74b4d0ad72..8c64794dff7311162b5a93259fa93c38ad1ee6b0 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
index f67cdd55bc47111f5f6fdcd0f181c4c9a68552f2..9a62ce614d0c85347b230f20d7109e2152162c23 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
index 5aa47a9e544067a0fce951ab5dcfb5c1f6a0ce9b..18f8c053134ddcec820b4da8a35dae99b4a92bd1 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
index 5a02f496400c43e900b6bbcc23d26a615b647ef7..dd17bfa37ed020c91d86d206a3cab2a91abc3dc9 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.MediaConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateReplyAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateReplyAction.java
index f39570cf3c34986ea6af0ffa9559f5578d469e64..e89e3eac48b21b985561744383b4f1b63899e34b 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateReplyAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
index 0b94d353ea519d0f02506a6594146a2876aa19ab..18ff0673a175067bbddea811b127bb7fe77e792a 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserMessageAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserMessageAction.java
index b4e9a82d1eeb2b498226a3ee9d84f08083d047f7..e8b75f39a5126fbbedb71cb42d651a587d98c981 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserMessageAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAction.java
index 96c1a4f2640ac21fa5cf7650a1e3a3a34fb08299..13a3dd1994f1b862f1819167c1192eb113241e65 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarBackgroundAction.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarBackgroundAction.java
index 85ebd7d08395534df2d3294cde7d8d8b46ab30eb..0eee4bdd0f23de23e237adb617237ae4e259b768 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarBackgroundAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarMediaAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarMediaAction.java
index 3ab854bdaf1593140f1403ad73108934507495e5..7c70b8f70ed0a082275cda7c755b751b6288deda 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteBotScriptAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteBotScriptAction.java
index e516361666951b2838f11f84958294129463073d..ff496dac9a805e29df2d846eac6a173344a035b7 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteBotScriptAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptSourceConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
index c2b719f086169b95e0c9bd7fb34dcd6870970c91..2064883e58e361555e972249f0858c1056857ba6 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ForumPostConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteIssueAction.java
index 70c8ca32b44967c1f65154ccd2a1e47b749b2611..57408fea9f88b4aea9900bf5e87a846588f929a4 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.IssueConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteResponseAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteResponseAction.java
index a2bdc5e0c21fad0bcaf45dbe92c0cbb71dbc313e..9c00c2ff9a16a9f026f245eda6edeb3f41152735 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteResponseAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ResponseConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDownBotScriptAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDownBotScriptAction.java
index 6e98c941e21d3c73f3dd98dc2360aee06c6ee4df..a7165d948a6f1c8d3ec94143a1c9125005f3dc56 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDownBotScriptAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptSourceConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
index d4206382290eaa75312de99f37911362d68f56b7..b81fb314524d65f247b86ecbd653202bceed3e92 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.*;
@@ -80,7 +80,7 @@ public class HttpFetchAction extends HttpUIResultAction {
         	cookies.putString(this.config.getType(), this.config.name);
         	cookies.flushSync();
 
-        	Class childAbility = MainAbility.getActivity(this.config);
+        	Class childAbility = MainAbility.getAbility(this.config);
         	if (this.launch && !this.config.isExternal) {
 	        	if (this.config instanceof ChannelConfig) {
 //	        		childAbility = LiveChatAbility.class;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchActionOffline.java
similarity index 31%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchActionOffline.java
index 47d182f66999a35d8b57e030816f13f2475d5e28..250fd5afcc3740eab4c25e40af0f499b7a6292d9 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchActionOffline.java
@@ -1,6 +1,6 @@
 /******************************************************************************
  *
- *  Copyright 2014 Paphus Solutions Inc.
+ *  Copyright 2017 Paphus Solutions Inc.
  *
  *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
  *  you may not use this file except in compliance with the License.
@@ -16,49 +16,103 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
+import org.botlibre.sdk.ResourceTable;
+import org.botlibre.sdk.ability.ChatAbility;
+import org.botlibre.sdk.ability.ListTemplateView;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.WebMediumConfig;
+import org.botlibre.sdk.micro.MicroConnection;
+import org.botlibre.sdk.util.LogUtils;
 import ohos.aafwk.ability.Ability;
+import ohos.agp.components.DirectionalLayout;
+import ohos.agp.components.LayoutScatter;
+import ohos.agp.components.Text;
+import ohos.agp.window.dialog.CommonDialog;
+import ohos.agp.window.service.Display;
+import ohos.agp.window.service.DisplayAttributes;
+import ohos.agp.window.service.DisplayManager;
 
-public class HttpFetchIssueAction extends HttpUIAction {
-    IssueConfig config;
+import java.util.Optional;
 
-    public HttpFetchIssueAction(Ability ability, IssueConfig config) {
+public class HttpFetchActionOffline extends HttpUIAction {
+    WebMediumConfig config;
+    MicroConnection microConnection = new MicroConnection();
+    boolean launch;
+
+    public HttpFetchActionOffline(Ability ability, WebMediumConfig config) {
+        super(ability);
+        this.config = config;
+    }
+
+
+    public HttpFetchActionOffline(Ability ability, WebMediumConfig config, boolean launch) {
         super(ability);
         this.config = config;
+        this.launch = launch;
+    }
+
+    @Override
+    protected void onPreExecute() {
+        Optional<Display>
+                display = DisplayManager.getInstance().getDefaultDisplay(ability.getContext());
+        DisplayAttributes displayAttributes = display.get().getAttributes();
+        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability.getContext()).
+                parse(ResourceTable.Layout_loading_dialog,
+                        null, false);
+        Text title = (Text) layout.findComponentById(ResourceTable.Id_title);
+        title.setText("Initializing Bot");
+        this.dialog = new CommonDialog(this.ability);
+        this.dialog.setContentCustomComponent(layout);
+        this.dialog.setAutoClosable(false);
+        this.dialog.setSize(displayAttributes.width - 100, 150);
+        this.dialog.show();
     }
 
     @Override
     protected String doInBackground(Void... params) {
+
         try {
-            this.config = MainAbility.connection.fetch(this.config);
+            //switch connections.
+            MainAbility.setOnline(false);
+            microConnection = (MicroConnection) MainAbility.connection;
+            this.config = microConnection.fetch(this.config);
         } catch (Exception exception) {
             this.exception = exception;
+            LogUtils.e("HttpFetchAction", exception.toString());
+            return "";
         }
-        return "";
-    }
 
-    @Override
-    public void onPostExecute(String xml) {
-        super.onPostExecute(xml);
+        if (this.ability instanceof ListTemplateView) {
+            this.ability.terminateAbility();
+        }
         if (this.exception != null) {
-            return;
+            return "";
         }
         try {
-            MainAbility.issue = this.config;
-
-//            if (this.ability instanceof IssueAbility) {
-//                this.ability.terminateAbility();
-//            }
-//
-//            startOpenAbility(this.ability, IssueAbility.class.getName());
+            MainAbility.instance = this.config;
+            Class childAbility = MainAbility.getAbility(this.config);
+            if (this.launch && !this.config.isExternal) {
+                if (this.config instanceof InstanceConfig) {
+                    childAbility = ChatAbility.class;
+                    HttpAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig) MainAbility.instance.credentials());
+                    action.execute();
+                }
+            }
+            startOpenAbility(this.ability, childAbility.getName());
         } catch (Exception error) {
             this.exception = error;
             MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-            return;
+            return "";
         }
+        return "";
     }
 
+    @SuppressWarnings("rawtypes")
+    @Override
+    public void onPostExecute(String xml) {
+        super.onPostExecute(xml);
+    }
 }
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchBotAvatarAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchBotAvatarAction.java
index 450488df8f5e8a014bd3f351003a115c7935bf66..d8f79f1dbf399cfecdaa73ee416ee7ebf77d14fb 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchBotAvatarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchChatAvatarAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchChatAvatarAction.java
index 213bebc6abf9f7f8fceeb894f4c730a055e388a0..fa0b984363739d8ad83de0e2db0f4b0312d6a1ed 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchChatAvatarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchForumPostAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchForumPostAction.java
index b723aacb1a676648f1a01c859c4fa8aaa2019c92..80792158bc52a62b67810af0e99d8ec99f57ef6b 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ForumPostConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchIssueAction.java
index 47d182f66999a35d8b57e030816f13f2475d5e28..60cdcae54bd5981feb4fca0d74a0c4dc01c6a124 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.IssueConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
index e0ef846b3a366a15c2f7175e0d617dbf16ac78d6..60e055ff9652220789ea2f35446a833013264940 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchUserAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchUserAction.java
index 7fe3d6bdc3ed27fc56041b2525a5e99bb339a420..309cb81618e3a61c587edbcd9e4bff39b57a892e 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.UserConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchWarAction.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchWarAction.java
index 5a4108c949a93a6fb987985b978d061f95e7cc16..26381dcf81a52e9020890c1944b5598ec9386f13 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchWarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.config.WebMediumConfig;
 import ohos.aafwk.ability.Ability;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagAction.java
index 92293cf14d773a4088d7d6b5c162cab10dc7b691..6be6e121b9890d159431f3a5ec817768277d725d 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagForumPostAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagForumPostAction.java
index 8782d8d0e169254356caab4fb9a9c54c17b0a599..1f2bb643445b9aaa71d0b39f16f0450dd7434ab6 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ForumPostConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagIssueAction.java
index ba7ee1b6a02bac03af0bc1b692089738deffc7fe..1accaa47641a1ff71684b3ddffbe7b2aff3b1294 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.IssueConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
index 876e4f00d97462425debd6f85421e70f670742cc..6222aeb7081223e23c9b016988fd98557e0e34ea 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.UserConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAdminsAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAdminsAction.java
index fb9f238d0892a499b5ce12aa9ce7bd9b2d38b5c4..e108044bc02e311f0c7187d32eadf23ec73165b6 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAdminsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
index 7859eeab096d36455c99abd8029e5de02cfec841..9e2aff1ba6938c2632039624bd30bdbd13535388 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptSourceAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptSourceAction.java
index 2e1f0d485d25c88bcf9345524b4e2737d63a2b9e..136e788c80c3bb456ebf074b820c33631bb085e8 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptSourceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptSourceConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptsAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptsAction.java
index 6702275bc375bb36b7890dcb9615be7dbf9ccd8a..b1876b7a2688c2a4a826701ace799e3eb2910981 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.InstanceConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetCategoriesAction.java
similarity index 98%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetCategoriesAction.java
index eea8e1fbe9cdf31c4114d20f96a81b013eb74697..150ed0856d28f2686e9d483e1d1d3bbad19295ff 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetCategoriesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ContentConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetChannelBotModeAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetChannelBotModeAction.java
index 54ce4a48090960bc13514419d93e41bb8d7cf3a4..8a33f9465dae904fd7193700d907ff2fec990d5e 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetChannelBotModeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetConversationsAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetConversationsAction.java
index 8405db85144d1a04de0662c6c208df09284acff4..ca2e164715300266566a94378ba22a2937f24660 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetConversationsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ConversationConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetForumBotModeAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetForumBotModeAction.java
index 7aeccc1f7248492df6cd3d373236ced01e6c105d..097da16513869b0cd5b59cc503e1a0d59ee2a2c0 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetForumBotModeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.BotModeConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
similarity index 99%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
index 710b66f9925d214f033f207c1ee90d339fbc801d..d9eb94280adbd2a4b22908c51895ae16ff014009 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.BrowseConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetIssuesAction.java
similarity index 98%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetIssuesAction.java
index 70a0f3dce20f49072019b2fb0a7f00ff06639e3c..8ddd1cda98d4e5ac00c3fe334b9e42a0f4246fc4 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetIssuesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.BrowseConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
index 078f1ed08c11e1be3798303dfe8282dd59983108..40e01a437282e334daf74a2f3f02e0b1d7225302 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.InstanceConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLiveChatUsersAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLiveChatUsersAction.java
index 2c9566f93726186856ca3f2f79218b05902dc1a6..4a32049f9eb652222593df49d9d35c14da193db3 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLiveChatUsersAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
similarity index 98%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
index 8162d98286151a7c0727c06c60b44a218dcf6ed5..09f2164cca848c27379a0ee2fcad425fd34291e4 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetResponsesAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetResponsesAction.java
index 560b4892c062ea316c871140714f2882df993625..ace1bddabe60b30a6d10c736164922c06c81b8f7 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetResponsesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetScriptSourceAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetScriptSourceAction.java
index a9dff7cd95d68685028b6350f19153281d3c6977..a45af42c1bf33b311770beb8a3aa59e18b41469f 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetScriptSourceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTagsAction.java
similarity index 98%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTagsAction.java
index b3a658f477c801e9aa4ce2de9ed20de10044954f..94a0ebf70202bf89b2b69bb152c04ed0beb3faed 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTagsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
index 2a8e59efd665ad22441d81beda15829da0519229..cf41f9c81aefcfb292699e84e16057d6138f270b 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetUsersAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetUsersAction.java
index 0b1eb32bf7b02b5e1fd40edd01abb83994444de7..e29ada173abe363352db32fdce3d9f859a55bfff 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetUsersAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetVoiceAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetVoiceAction.java
index 6e8cbe4941bc973d30568267d0333cea0d2494bf..c35f9dbb565b916d489148f6d47d574c968a1113 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetVoiceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotLogAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotLogAction.java
index 2de192312807f618aa88b9147b9a9e89ddd7a8de..890a120e3847753bb3f5d342e75582bb7703885e 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotLogAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotScriptAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotScriptAction.java
index c984d17e2436d7149cbf1d4baf108c85af6fa5aa..1c1efd6390481be1291094f1cf928713f976ee7f 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotScriptAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageInstancesAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageInstancesAction.java
index 0431d849bd37355817bf8f6a6a03c9994f5db279..1cdbe1ba8c0d0e2c8adc8811f57ee86854ffc8b0 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageInstancesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageIssuesAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageIssuesAction.java
index 74aef5d5a0035f65043618cc78f922f1f71d7c35..3af4248a8de15f9c6d1ae33f6bea9579965a1eee 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageIssuesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPagePostsAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPagePostsAction.java
index 2d5fdea8ad00f43bd4d6a19e8b1980afa53d00f6..cffe81b03f37193e3ff912eaa513cde88fcf96cf 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPagePostsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpRefreshAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpRefreshAction.java
index db5535421227d2c23a13a850106d620e6a845a3f..ac80bcc174553a3c140aefcf74e05e8ea8ced10c 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpRefreshAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
  
- package org.botlibre.sdk.activityy.actions;
+ package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
similarity index 89%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
index 22af1fed73d6fef34c004eb62b44ee19fbd64fd8..c19fac43f39271c9d2bff736e6f170c20cc34f26 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
@@ -39,7 +39,10 @@ public abstract class HttpResultAction{
     }
 
     /**
-     * 启动activity
+     * 启动ability
+     *
+     * @param ability ability
+     * @param name name
      */
     public void startOpenAbility(Ability ability, String name) {
         Intent intent = new Intent();
@@ -53,7 +56,11 @@ public abstract class HttpResultAction{
     }
 
     /**
-     * 启动activity
+     * 启动ability
+     *
+     * @param ability ability
+     * @param name name
+     * @param requestCode requestCode
      */
     public void startOpenAbilityForResult(Ability ability, String name, int requestCode) {
         Intent intent = new Intent();
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarBackgroundAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarBackgroundAction.java
index 587c7257adf18e8ff6152b619796f1b5d5758fe6..5dbe144d9c587df14629658b65d70234761c5100 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarBackgroundAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarMedia;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarMediaAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarMediaAction.java
index 18ee6f3a64b78423e963651d94399f2fc612f5d6..9d2f34f17d18d21cbe719b8446ae5b3294d75591 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarMedia;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotAvatarAction.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotAvatarAction.java
index 7031146ac6d3001f5e4daa85e1c1986f65c0f267..6b9a1ffcb3ddfc224a34908caa057120eab03829 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotAvatarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotScriptSourceAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotScriptSourceAction.java
index 08122ddf48e99870f10fd153798c5951a92de145..757f22710477b641a2347e95aee2339c3e513aa3 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotScriptSourceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveChannelBotModeAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveChannelBotModeAction.java
index c8b6665c06a055ea9b1bd3a3c68cfd635fd63fcc..d68cb564a3f48ab9190720e96737e781bc10bde1 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveChannelBotModeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveForumBotModeAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveForumBotModeAction.java
index a03999fb83df6d6e0ec3247eeb18647c37ffffe0..e543c5335d36dfd3c6f41966c49f7607da4573d6 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveForumBotModeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveLearningAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveLearningAction.java
index 1e8b761a241003d8c0f132817940ac94fe6913ef..02dbde72f791c2e0cbb16a0a3d7af20f451f890e 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveLearningAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveResponseAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveResponseAction.java
index e075572af1516334f9c6aac798a261e712b7361d..4cd099a42926ddb86cd7e7776021eefa071e021d 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveResponseAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveScriptSourceAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveScriptSourceAction.java
index 9c636ff8ab32cb8be007c0e09b2319c60bbb7fbc..1bdb6bfba89c4cebbbbb72a2200c5cc5259c69e2 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveScriptSourceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveVoiceAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveVoiceAction.java
index 1a1228828e020c531e56dfdddf61517feb88193a..e0029f3152d3363f756075c69a6a8686ad69d1eb 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveVoiceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSpeechAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSpeechAction.java
index eeed3b90239cadccad6791df57c85f8a2f706458..4713af14569d81a40780a40e8d7d5a044a2311c9 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSpeechAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarAction.java
index 3cf693ce0e206042caef81d3a9caf9cf2e92f485..fa4dd010d160e8993c0d95eecc4f03c11c0eed43 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarIssueAction.java
index 8d06013cea0c233e4b17f01bb3fb03260a3b6de7..37f42a6e21e6f75669e4f29b71a33616a16ac035 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarPostAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarPostAction.java
index c8156298a108b82394309f8727bb2d6d445cb5b6..362254f33d49f9cb754f79ff070217b410625268 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeAction.java
index fd20173aafdf9c5f44e249b6f933a32fae571d50..0e8d6becef2d1f80820a308c5b70fe21ad60cb6e 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeForumAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeForumAction.java
index 0031ff92da6c9fbb2fde53ec00b864349c57142a..5596e5e9b8cbd9dae95b99ec593be4044f774e39 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeForumAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeIssueAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeIssueAction.java
index 78dd4d46c6e5158d26570ee9bf76e3096f906b2c..39c23eb175bc36235dd9b8a93eb273f343748093 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownAction.java
index dc358e874865654b88dd5c2c8edaf594cb7dc68e..a86ba055c262814625aba8e215a36a587ec2712b 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownIssueAction.java
index ee2348f437b3b5608dbf8f529715d1e34dbbb790..7a7e0f428f8c211ec0cc19bafd991bf90dc1b0c6 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownPostAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownPostAction.java
index fa19590eace83bb6798d6257e8f09ddb393cfb23..7a59fbba011d88e10e503643608314f64ce86b8b 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpAction.java
index b030c09091b9bc65b168e203d139a5b621c96ecc..b0126f3043fd292d91f49a385c5cf0eaf44da196 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpIssueAction.java
index 0c34c41412887316a1229c8c9190268a3c160ce3..da56faca17c9ec29891f829a935ba9c1d9b93657 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.IssueConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpPostAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpPostAction.java
index a843d0794353081e9ad62d22b70c06a53f0825d9..6e37aabe120c4c4cb5ce83ab2aef921b429884eb 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
similarity index 98%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
index 272969d74471a4ceaf9f84ee2d50d2d06850d58b..f0093abe4928264a0e779a964ff7c836f7cbb33c 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
similarity index 98%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
index 364bee86c2792588d97d9e6be34525b4b4d93301..db20c9023af46e0008fb620fd18187d4a867c22d 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeAction.java
index 938262e5f1cdd51b81a07b885856a86257a2b382..dad3fbad1d8b2330d35b0cebeb9268c22d862333 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeForumAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeForumAction.java
index 7c4c9179fc335c1d23f6a5099660e1c5e1c3fafc..77dc0015f06fafcf47268aa4e2f425b77f7fa89e 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeForumAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeIssueAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeIssueAction.java
index 229fa929e0a4c2cd33972f85edb50cf78ba973ec..8123b845b3e61bfa8492912f373d4168b91cbb79 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpBotScriptAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpBotScriptAction.java
index 9d456711443e3bfd3b84c96a1eb8d04098a2c05c..ee4c2d3549ac156c03023e1a18663589784c0d13 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpBotScriptAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptSourceConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateAction.java
index cafad9bad01c877f74826c37c25ac8307af9a2ad..77ec1d84c42616aa7415302fbea0547a089b99aa 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateForumPostAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateForumPostAction.java
index 846ae93004bdb99f9e7051145baca1504d0cee32..b325daba805a9c907a7f79137b1f8a8346b0bec1 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateIssueAction.java
index 2374b85e68a40b26560ca137f780c2ec40d12af3..3723641a016e8714ce69ad40b6595ff4ad2af623 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateUserAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateUserAction.java
index 2a412260e4c52dc1da04735e66f99bf698569930..0097bbc6e66a2ef6905f9bcc60944694863849f8 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUploadGraphicMediaAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUploadGraphicMediaAction.java
index b7b7065c55055ee1590601dea625bf7559aa69ad..63419c8d226e769376b37cbbefd0002b6ba38f0c 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUploadGraphicMediaAction.java
@@ -15,7 +15,7 @@
  *  limitations under the License.
  *
  ******************************************************************************/
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserAdminAction.java
similarity index 98%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserAdminAction.java
index 2124ff3c5497c51f6400e661949cadd76313d638..cff08c49b2ecdc816029eb2c01c7092b699cca28 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserAdminAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserMessageAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserMessageAction.java
index 76cd86884ffbabae44d1f09483764a44036ee87a..4b23f23180e69ff3a39b179709851310d790f9ae 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserMessageAction.java
@@ -16,7 +16,7 @@
 *
 ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/WarAction.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/WarAction.java
index 01215f2ed60eea3d5a4d4c6fccc2078af443ef93..ef0a8257460de4c558d8dd401cf4903b653756dc 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/actions/WarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.config.ChatResponse;
 
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
similarity index 96%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
index 0a708de062101d0f440fbab96dd0eb7051bd493d..6b6e5f7a5b4508551fdbe969d3169da9981da5e5 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
@@ -13,7 +13,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.adapter;
+package org.botlibre.sdk.ability.adapter;
 
 import org.botlibre.sdk.ResourceTable;
 import ohos.aafwk.ability.Ability;
@@ -30,7 +30,7 @@ import ohos.agp.components.Text;
  * @since 2021-05-10
  */
 public class SpinnerAdapter extends BaseItemProvider {
-    private final Ability mActivity;
+    private final Ability mAbility;
     private final LayoutScatter mInflater;
     private final String[] types;
 
@@ -41,7 +41,7 @@ public class SpinnerAdapter extends BaseItemProvider {
      * @param types types
      */
     public SpinnerAdapter(Ability ability, String[] types) {
-        mActivity = ability;
+        mAbility = ability;
         this.types = types;
         mInflater = LayoutScatter.getInstance(ability);
     }
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
similarity index 74%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
index 1ba617525f7f0225dbdb153a853e35ffcc005dd1..a75ead36800635748095bc8f89239222aa9e7517 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.avatar;
+package org.botlibre.sdk.ability.avatar;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
@@ -31,14 +31,13 @@ import ohos.data.preferences.Preferences;
 import java.util.ArrayList;
 
 /**
- * Activity used for selecting an offline avatar.
+ *  used for selecting an offline avatar.
  */
 public class AvatarSelection extends Ability {
 
 	@Override
 	public void onStart(Intent intent) {
 		super.onStart(intent);
-//		setContentView(R.layout.activity_list_view);
 		super.setUIContent(ResourceTable.Layout_ability_list_view);
 		final int [] imges = {};
 		final String [] names = {};
@@ -48,16 +47,7 @@ public class AvatarSelection extends Ability {
 		for (int i = 0; i < names.length; i++) {
 			items.add(new OfflineTemplateConfig(imges[i],names[i],null,null));
 		}
-//		CustomListViewAdapter adapter = new CustomListViewAdapter(this, R.layout.list_item_imager, items);
-//		listView.setAdapter(adapter);
-//		listView.setOnItemClickListener(new OnItemClickListener(){
-//			@Override
-//			public void onItemClick(AdapterView<?> parent, View view, int position, long id) {
-//				OfflineTemplateConfig template = (OfflineTemplateConfig) (listView.getItemAtPosition(position));
-//				saveSelectedAvatar(template.getTitle());
-//				MainActivity.readZipAvatars(AvatarSelection.this, MainActivity.nameOfAvatar);
-//				finish();
-//			}});
+
 	}
 
 	public static void saveSelectedAvatar(String nameOfAvatar) {
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
index c15fc3a71ee6f86d77cbb6fcd913ea40914d24b5..b14752da2ad09c11c8ac78699949724ab1af4531 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
@@ -13,12 +13,12 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.LanguageListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.LanguageListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
index a1f99136eee7867944196c488934bdfef0482374..34c67053c103c3e2a87c24dca243287ed1c7ee15 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
@@ -13,11 +13,11 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
similarity index 96%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
index 929116aa9dc948e3e73c7225d35bcad2c4b79efe..d8caef1fa97f65a4d41c50e0c281907e74135f3d 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
@@ -13,12 +13,12 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
similarity index 93%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
index 776ecddd89448fdd01e97b8cd024a4ce6736c227..3523cf20581e7e5363540572e970d9c6d79fe278 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.listener;
+package org.botlibre.sdk.ability.listener;
 
 /**
  * Listener interface for a LiveChatConnection.
@@ -25,6 +25,8 @@ package org.botlibre.sdk.activityy.listener;
 public interface LanguageListener {
 	/**
 	 * A user message was received from the channel.
+	 *
+	 * @param select select
 	 */
 	void selectLanguageItem(String select);
 }
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
similarity index 93%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
index 237a4130230d4315b6104d3b10fd8da115e72fed..60077f9e5814e5ac0274ab168b026d2a972c7e6a 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.listener;
+package org.botlibre.sdk.ability.listener;
 
 /**
  * Listener interface for a LiveChatConnection.
@@ -25,6 +25,8 @@ package org.botlibre.sdk.activityy.listener;
 public interface SelectListener {
 	/**
 	 * A user message was received from the channel.
+	 *
+	 * @param select select
 	 */
 	void selectItem(String select);
 }
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
similarity index 95%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
index f943da9e2cbeee5b38c510ba220f2c56237be175..7d0c9ee38abd0e72dae4d758dbfb3b6108be35eb 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
@@ -1,4 +1,4 @@
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 import org.botlibre.sdk.config.Config;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
similarity index 80%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
index ac0405d955ae27c6ef32f219ba714625c676f441..1c0419f9a72e8569c22923923a87c3b55b740012 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
@@ -1,7 +1,7 @@
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.actions.HttpUIAction;
+import org.botlibre.sdk.ability.actions.HttpUIAction;
 import org.botlibre.sdk.config.InstanceConfig;
 import ohos.aafwk.ability.Ability;
 
@@ -9,8 +9,8 @@ public class HttpChatWarAction extends HttpUIAction {
 	ChatWarConfig config;
 	InstanceConfig instance;
 
-	public HttpChatWarAction(Ability activity, ChatWarConfig config) {
-		super(activity);
+	public HttpChatWarAction(Ability ability, ChatWarConfig config) {
+		super(ability);
 		this.config = config;
 	}
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java
rename to BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
index 0e3bb78a893e66f9befea773c0a0eb53c5276bda..b1c3f9e0f139105b7da0ae2041ae5c33c51607d3 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
@@ -16,14 +16,14 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.LibreAbility;
-import org.botlibre.sdk.activityy.actions.HttpFetchWarAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.LibreAbility;
+import org.botlibre.sdk.ability.actions.HttpFetchWarAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
 import org.botlibre.sdk.config.BrowseConfig;
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java
deleted file mode 100644
index c83873af7985cd5cf6ac35ddc8fb4e46e5fb47e3..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java
+++ /dev/null
@@ -1,68 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.AvatarMedia;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.window.dialog.CommonDialog;
-
-public class HttpAddAvatarMediaAction extends HttpUIResultAction {
-
-	AvatarMedia config;
-	String file;
-	
-	public HttpAddAvatarMediaAction(Ability ability, String file, AvatarMedia config) {
-		super(ability);
-		this.config = config;
-		this.file = file;
-	}
-
-//	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.createAvatarMedia(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-//	@Override
-	protected void onPreExecute() {
-		this.dialog = new CommonDialog(this.ability);
-		//this.dialog.setCancelable(false);
-		this.dialog.setContentText("Uploading...");
-		this.dialog.show();
-	}
-
-//	@Override
-	protected void onPostExecute(String xml) {
-//		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		HttpGetAvatarMediaAction action = new HttpGetAvatarMediaAction(this.ability, (AvatarConfig)MainAbility.instance.credentials(), true);
-//		action.execute();
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java
deleted file mode 100644
index d1896c134c2a1f85081b043a0f55f36604a89ba6..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpChangeUserIconAction extends HttpUIAction {
-
-    UserConfig config;
-    String file;
-
-    public HttpChangeUserIconAction(Ability ability, String file, UserConfig config) {
-        super(ability);
-        this.config = config;
-        this.file = file;
-    }
-
-//    @Override
-    protected String doInBackground(Void... params) {
-        try {
-            this.config = MainAbility.connection.updateIcon(this.file, this.config);
-        } catch (Exception exception) {
-            this.exception = exception;
-        }
-        return "";
-    }
-
-//    @Override
-    public void onPostExecute(String xml) {
-//        super.onPostExecute(xml);
-        if (this.exception != null) {
-            return;
-        }
-        try {
-            MainAbility.user = this.config;
-            MainAbility.viewUser = this.config;
-//            ((ViewUserAbility) this.ability).resetView();
-        } catch (Exception error) {
-            this.exception = error;
-            MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-            return;
-        }
-    }
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java
deleted file mode 100644
index 70c8ca32b44967c1f65154ccd2a1e47b749b2611..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpDeleteIssueAction extends HttpUIAction {
-
-	IssueConfig config;
-
-	public HttpDeleteIssueAction(Ability ability, IssueConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-        MainAbility.issues.remove(this.config);
-    	
-		this.ability.terminateAbility();
-    }
-
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java
deleted file mode 100644
index 0ad3a44c5ad61463e081e9ae487eee39ab225787..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java
+++ /dev/null
@@ -1,140 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2017 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.activityy.ListTemplateView;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.micro.MicroConnection;
-import org.botlibre.sdk.util.LogUtils;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.components.DirectionalLayout;
-import ohos.agp.components.LayoutScatter;
-import ohos.agp.components.Text;
-import ohos.agp.window.dialog.CommonDialog;
-import ohos.agp.window.service.Display;
-import ohos.agp.window.service.DisplayAttributes;
-import ohos.agp.window.service.DisplayManager;
-
-import java.util.Optional;
-
-public class HttpFetchActionOffline extends HttpUIAction {
-	WebMediumConfig config;
-	MicroConnection microConnection = new MicroConnection();
-	boolean launch;
-
-	public HttpFetchActionOffline(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	
-	public HttpFetchActionOffline(Ability ability, WebMediumConfig config, boolean launch) {
-		super(ability);
-		this.config = config;
-		this.launch = launch;
-	}
-	
-	@Override
-	protected void onPreExecute() {
-		Optional<Display>
-				display = DisplayManager.getInstance().getDefaultDisplay(ability.getContext());
-		DisplayAttributes displayAttributes = display.get().getAttributes();
-		DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability.getContext()).
-				parse(ResourceTable.Layout_loading_dialog,
-						null, false);
-		Text title = (Text)layout.findComponentById(ResourceTable.Id_title);
-		title.setText("Initializing Bot");
-		this.dialog = new CommonDialog(this.ability);
-		this.dialog.setContentCustomComponent(layout);
-		this.dialog.setAutoClosable(false);
-		this.dialog.setSize(displayAttributes.width - 100,150);
-		this.dialog.show();
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-	
-		try {
-			//switch connections.
-			MainAbility.setOnline(false);
-			microConnection = (MicroConnection) MainAbility.connection;
-			this.config = microConnection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-			LogUtils.e("HttpFetchAction", exception.toString());
-			return "";
-		}
-
-		if(this.ability instanceof ListTemplateView){
-			this.ability.terminateAbility();
-		}
-		if (this.exception != null) {
-			return "";
-		}
-		try {
-			MainAbility.instance = this.config;
-			Class childAbility = MainAbility.getActivity(this.config);
-			if (this.launch && !this.config.isExternal) {
-				if (this.config instanceof InstanceConfig) {
-					childAbility = ChatAbility.class;
-					HttpAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-					action.execute();
-				}
-			}
-			startOpenAbility(this.ability,childAbility.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return "";
-		}
-		return "";
-	}
-
-	@SuppressWarnings("rawtypes")
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-//		if(this.ability instanceof ListTemplateView){
-//			this.ability.terminateAbility();
-//		}
-//		if (this.exception != null) {
-//			return;
-//		}
-//		try {
-//			MainAbility.instance = this.config;
-//        	Class childAbility = MainAbility.getActivity(this.config);
-//        	if (this.launch && !this.config.isExternal) {
-//	        	if (this.config instanceof InstanceConfig) {
-//	        		childAbility = ChatAbility.class;
-//	        		HttpAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-//	        		action.execute();
-//	        	}
-//	        }
-//			startOpenAbility(this.ability,childAbility.getName());
-//		} catch (Exception error) {
-//			this.exception = error;
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//			return;
-//		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java
deleted file mode 100644
index 213bebc6abf9f7f8fceeb894f4c730a055e388a0..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFetchChatAvatarAction extends HttpUIAction {
-	AvatarConfig config;
-
-	public HttpFetchChatAvatarAction(Ability ability, AvatarConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((ChatAbility)this.ability).resetAvatar(this.config);
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java
deleted file mode 100644
index 7fe3d6bdc3ed27fc56041b2525a5e99bb339a420..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFetchUserAction extends HttpUIAction {
-	UserConfig config;
-	boolean launch;
-
-	public HttpFetchUserAction(Ability ability, UserConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.viewUser = this.config;
-//			startOpenAbility(this.ability, ViewUserAbility.class.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java
deleted file mode 100644
index 5a4108c949a93a6fb987985b978d061f95e7cc16..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java
+++ /dev/null
@@ -1,36 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFetchWarAction extends HttpFetchAction {
-
-	public HttpFetchWarAction(Ability ability, WebMediumConfig config) {
-		super(ability, config);
-	}
-
-//	@Override
-	public void onPostExecute(String xml) {
-//		super.superOnPostExecute(xml);
-//		StartWarAbility.bot1 = (InstanceConfig)this.config;
-//		((StartWarAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java
deleted file mode 100644
index 8782d8d0e169254356caab4fb9a9c54c17b0a599..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFlagForumPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpFlagForumPostAction(Ability ability, ForumPostConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.flag(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.post.isFlagged = true;
-//	    this.ability.findComponentById(ResourceTable.flaggedLabel).setVisibility(VISIBLE);
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java
deleted file mode 100644
index ba7ee1b6a02bac03af0bc1b692089738deffc7fe..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFlagIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpFlagIssueAction(Ability ability, IssueConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.flag(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.issue.isFlagged = true;
-//	    this.ability.findComponentById(ResourceTable.flaggedLabel).setVisibility(VISIBLE);
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java
deleted file mode 100644
index fb9f238d0892a499b5ce12aa9ce7bd9b2d38b5c4..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java
+++ /dev/null
@@ -1,61 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpGetAdminsAction extends HttpUIAction {
-
-	WebMediumConfig config;
-	List<String> users;
-	
-	public HttpGetAdminsAction(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.users = MainAbility.connection.getAdmins(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((WebMediumUsersAbility)this.ability).admins = this.users;
-//			((WebMediumUsersAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java
deleted file mode 100644
index 6702275bc375bb36b7890dcb9615be7dbf9ccd8a..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.ScriptConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.List;
-
-public class HttpGetBotScriptsAction extends HttpUIAction {
-
-	InstanceConfig config;
-	List<ScriptConfig> scripts;
-	
-	public HttpGetBotScriptsAction(Ability ability, InstanceConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.scripts = MainAbility.connection.getBotScripts(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((BotScriptsAbility)this.ability).setScriptList(this.scripts);
-//			((BotScriptsAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java
deleted file mode 100644
index 95951bbd27859e768e4d9e9dd3198f68146c9f2e..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java
+++ /dev/null
@@ -1,287 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.io.File;
-import java.io.FileOutputStream;
-import java.io.InputStream;
-import java.lang.ref.SoftReference;
-import java.net.URL;
-import java.util.Hashtable;
-import java.util.Map;
-
-import org.botlibre.sdk.MainAbility;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.components.Component;
-import ohos.agp.components.Image;
-import ohos.app.Context;
-import ohos.media.image.PixelMap;
-
-public class HttpGetImageAction extends HttpAction {
-	public static int MAX_HEIGHT = 1200;
-	public static int MAX_WIDTH = 600;
-	public static int MAX_FILES = 100;
-	
-	public static volatile boolean downloading;
-	
-	public static File cacheDir;
-	public static Map<String, SoftReference<PixelMap>> imageCache = new Hashtable<String, SoftReference<PixelMap>>();
-	
-	String image;
-	PixelMap bmp;
-	Image view;
-	
-	
-	
-	public static void setImage(int imageId, Component view){
-		if(view instanceof Image){
-//			((Image) view).setImageResource(imageId);
-		}
-	}
-	
-	public static void clearFileCache(Context context) {
-		try {
-			File[] files = getFileCacheDir(context).listFiles();
-	        if (files == null) {
-	            return;
-	        }
-	        for (File file : files) {
-	        	if (file.isDirectory()) {
-	        		File[] nested = file.listFiles();
-	    	        for (File nestedFile : nested) {
-	    	        	if (!nestedFile.isDirectory()) {
-	    	        		nestedFile.delete();
-	    	        	}
-	    	        }
-	        	} else {
-	        		file.delete();
-	        	}
-	        }
-		} catch (Exception failed) {
-//			Log.wtf(failed.toString(), failed);
-		}
-    }
-	
-    public static File getFileCacheDir(Context context) {
-    	if (cacheDir == null) {
-    		try {
-
-		            cacheDir = context.getCacheDir();
-		        if (!cacheDir.exists()) {
-		            cacheDir.mkdirs();
-		        }
-    		} catch (Exception failed) {
-    			failed.printStackTrace();
-    			return null;
-    		}
-    	}
-    	return cacheDir;
-    }
-    
-    public static File getFile(String filename, Context context) {
-    	File dir = getFileCacheDir(context);
-    	if (dir == null) {
-    		return null;
-    	}
-    	
-    	File file = new File(dir.getAbsolutePath() + "/" + filename);
-    	dir = new File(file.getParent());
-    	if (!dir.exists()) {
-    		dir.mkdir();
-    	} else {
-	        File[] files = dir.listFiles();
-	    	if (files.length > MAX_FILES) {
-    	        for (File nestedFile : files) {
-    	        	if (!nestedFile.isDirectory()) {
-    	        		nestedFile.delete();
-    	        	}
-    	        }	    		
-	    	}
-    	}
-    	return file;
-    }
-	
-    public static File getFile(String dirName, String filename, Context context) {
-    	File dir = getFileCacheDir(context);
-    	if (dir == null) {
-    		return null;
-    	}
-    	
-    	File file = new File(dir.getAbsolutePath() + "/" + dirName + "/" + filename);
-    	dir = new File(file.getParent());
-    	if (!dir.exists()) {
-    		dir.mkdir();
-    	} else {
-	        File[] files = dir.listFiles();
-	    	if (files.length > MAX_FILES) {
-    	        for (File nestedFile : files) {
-    	        	if (!nestedFile.isDirectory()) {
-    	        		nestedFile.delete();
-    	        	}
-    	        }	    		
-	    	}
-    	}
-    	return file;
-    }
-	
-	public static void fetchImage(Ability Ability, String image, Image view) {
-		if (image == null) {
-			return;
-		}
-		SoftReference<PixelMap> ref = imageCache.get(image);
-		if (ref != null) {
-			PixelMap bmp = ref.get();
-			if (bmp != null) {
-				if (view instanceof Image) {
-					view.setPixelMap(bmp);
-				}
-		        return;
-			}
-		}
-        HttpGetImageAction action = new HttpGetImageAction(Ability, image, view);
-    	try {
-    		action.execute().get();
-    		action.postExecute();
-    		if (action.getException() != null) {
-    			throw action.getException();
-    		}
-    	} catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-    		return;
-    	}
-	}
-	
-	public HttpGetImageAction(Ability Ability) {
-		super(Ability);
-	}
-	
-	public HttpGetImageAction(Ability Ability, String image, Image view) {
-		super(Ability);
-		this.image = image;
-		this.view = view;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-        try {
-	        URL url = MainAbility.connection.fetchImage(this.image);
-		    
-		    /*BitmapFactory.Options options = new BitmapFactory.Options();
-		    options.inJustDecodeBounds = true;
-		    long start = System.currentTimeMillis();
-		    InputStream stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream, null, options);
-		    stream.close();
-		    System.out.println("decodeStream1:" + (System.currentTimeMillis() - start));
-
-	        int height = options.outHeight;
-	        int width = options.outWidth;
-	        options.inPreferredConfig = Bitmap.Config.RGB_565;
-	        int inSampleSize = 1;
-
-	        if (height > MAX_HEIGHT) {
-	            inSampleSize = Math.round((float)height / (float)MAX_HEIGHT);
-	        }
-
-	        int expectedWidth = width / inSampleSize;
-
-	        if (expectedWidth > MAX_WIDTH) {
-	            inSampleSize = Math.round((float)width / (float)MAX_WIDTH);
-	        }
-
-		    options.inSampleSize = inSampleSize;
-		    options.inJustDecodeBounds = false;
-
-		    start = System.currentTimeMillis();
-		    stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream, null, options).recycle();
-		    stream.close();
-		    System.out.println("decodeStream2:" + (System.currentTimeMillis() - start));
-
-		    start = System.currentTimeMillis();
-		    stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream).recycle();
-		    stream.close();
-		    System.out.println("decodeStream-full:" + (System.currentTimeMillis() - start));*/
-
-		    File file = getFile(this.image, this.ability);
-		    if (!file.exists()) {
-		    	downloading = true;
-		    	file.createNewFile();
-		    	FileOutputStream outputStream = new FileOutputStream(file);
-			    InputStream stream = url.openConnection().getInputStream();
-		    	byte[] bytes= new byte[1024];
-		    	int count = 0;
-	            while (count != -1) {
-	            	count = stream.read(bytes, 0, 1024);
-		            if (count == -1) {
-		            	break;
-		            }
-		            outputStream.write(bytes, 0, count);
-	            }
-	            stream.close();
-	            outputStream.close();
-		    	downloading = false;
-		    }
-
-//		    BitmapFactory.Options options = new BitmapFactory.Options();
-//		    options.inJustDecodeBounds = true;
-//		    InputStream stream = new FileInputStream(file);
-//		    BitmapFactory.decodeStream(stream, null, options);
-//		    stream.close();
-//
-//	        int height = options.outHeight;
-//	        int width = options.outWidth;
-//	        options.inPreferredConfig = Bitmap.Config.RGB_565;
-//	        int inSampleSize = 1;
-//	        if (height > MAX_HEIGHT) {
-//	            inSampleSize = Math.round((float)height / (float)MAX_HEIGHT);
-//	        }
-//	        int expectedWidth = width / inSampleSize;
-//	        if (expectedWidth > MAX_WIDTH) {
-//	            inSampleSize = Math.round((float)width / (float)MAX_WIDTH);
-//	        }
-//		    options.inSampleSize = inSampleSize;
-//		    options.inJustDecodeBounds = false;
-//
-//		    stream = new FileInputStream(file);
-//		    this.bmp = BitmapFactory.decodeStream(stream, null, options);
-//		    stream.close();
-//
-//	        imageCache.put(this.image, new SoftReference<Bitmap>(this.bmp));
-	        return "";
-        } catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-        }
-        return null;
-	}
-
-	protected void postExecute() {
-		if (view instanceof Image) {
-//			((Image)view).setImageBitmap(bmp);
-		}
-//		else if (view instanceof Button) {
-////			((Button)view).setBackgroundDrawable(new BitmapDrawable(view.getResources(), bmp));
-//		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java
deleted file mode 100644
index 70a0f3dce20f49072019b2fb0a7f00ff06639e3c..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java
+++ /dev/null
@@ -1,76 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-import ohos.aafwk.content.Intent;
-
-import java.util.List;
-
-public class HttpGetIssuesAction extends HttpUIAction {
-	BrowseConfig config;
-	List<IssueConfig> issues;
-	boolean finish = false;
-
-	public HttpGetIssuesAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	public HttpGetIssuesAction(Ability Ability, BrowseConfig config, boolean finish) {
-		super(Ability);
-		this.config = config;
-		this.finish = finish;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.issues = MainAbility.connection.getIssues(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.issues = this.issues;
-		
-		if (this.finish) {
-			this.ability.terminateAbility();
-		}
-		MainAbility.browseIssues = this.config;
-		Intent intent = new Intent();
-//		Operation operation = new Intent.OperationBuilder()
-//				.withDeviceId("")
-//				.withBundleName(this.ability.getBundleName())
-//				.withAbilityName(BrowseIssueAbility.class.getName())
-//				.build();
-//		intent.setOperation(operation);
-		this.ability.startAbility(intent);
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java
deleted file mode 100644
index 2c9566f93726186856ca3f2f79218b05902dc1a6..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java
+++ /dev/null
@@ -1,61 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetLiveChatUsersAction extends HttpAction {
-	String csv;
-	List<UserConfig> users;
-
-	public HttpGetLiveChatUsersAction(Ability Ability, String csv) {
-		super(Ability);
-		this.csv = csv;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.users = MainAbility.connection.getUsers(this.csv);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((LiveChatAbility)this.ability).setUsers(this.users);
-	
-		} catch (Exception error) {
-			this.exception = error;
-			return;			
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java
deleted file mode 100644
index 560b4892c062ea316c871140714f2882df993625..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java
+++ /dev/null
@@ -1,65 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ResponseConfig;
-import org.botlibre.sdk.config.ResponseSearchConfig;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetResponsesAction extends HttpUIAction {
-
-	ResponseSearchConfig config;
-	List<ResponseConfig> responses;
-	
-	public HttpGetResponsesAction(Ability Ability, ResponseSearchConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.responses = MainAbility.connection.getResponses(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		try {
-//			((TrainingAbility)this.ability).setResponses(this.responses);
-//			((TrainingAbility)this.ability).resetView();
-//		} catch (Exception error) {
-//			this.exception = error;
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//			return;
-//		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java
deleted file mode 100644
index a9dff7cd95d68685028b6350f19153281d3c6977..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetScriptSourceAction extends HttpUIAction {
-	ScriptConfig config;
-	ScriptSourceConfig script;
-	
-	public HttpGetScriptSourceAction(Ability Ability, ScriptConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.script = MainAbility.connection.getScriptSource(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.script = this.script;
-			
-//			((ScriptEditorAbility)this.ability).resetView();
-			
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java
deleted file mode 100644
index fa59737fed7c834f60f88e4b4b0b9925aad5ca5a..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java
+++ /dev/null
@@ -1,107 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.io.File;
-import java.io.FileOutputStream;
-import java.io.InputStream;
-import java.net.URL;
-
-import org.botlibre.sdk.MainAbility;
-
-import ohos.aafwk.ability.Ability;
-import ohos.utils.net.Uri;
-
-public class HttpGetVideoAction extends HttpGetImageAction {
-	
-	String video;
-	
-	public static Uri fetchVideo(Ability Ability, String video) {
-//		if(!MainAbility.online){
-//			 File file = getFile(GetAvatarAction.nameOfFile,video, Ability);
-//			 return Uri.getUriFromFile(file);
-//		}
-		
-		if (video == null) {
-			return null;
-		}
-		
-    	if (downloading) {
-    		return null;
-    	}
-	    File file = getFile(video, Ability);
-	    if (file.exists()) {
-	    	if (downloading) {
-	    		return null;
-	    	}
-	    	return Uri.getUriFromFile(file);
-	    }
-			HttpGetVideoAction action = new HttpGetVideoAction(Ability, video);
-			try {
-				action.execute().get();
-				if (action.getException() != null) {
-					throw action.getException();
-				}
-			} catch (Exception exception) {
-				if (MainAbility.DEBUG) {
-					exception.printStackTrace();
-				}
-			}
-		return Uri.getUriFromFile(file);
-	}
-	
-	public HttpGetVideoAction(Ability Ability, String video) {
-		super(Ability);
-		this.video = video;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-        try {
-	        URL url = MainAbility.connection.fetchImage(this.video);
-
-		    File file = getFile(this.video, this.ability);
-		    if (!file.exists()) {
-		    	downloading = true;
-		    	file.createNewFile();
-		    	FileOutputStream outputStream = new FileOutputStream(file);
-			    InputStream stream = url.openConnection().getInputStream();
-		    	byte[] bytes= new byte[1024];
-		    	int count = 0;
-	            while (count != -1) {
-	            	count = stream.read(bytes, 0, 1024);
-		            if (count == -1) {
-		            	break;
-		            }
-		            outputStream.write(bytes, 0, count);
-	            }
-	            stream.close();
-	            outputStream.close();
-		    	downloading = false;
-		    }
-	        return "";
-        } catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-	    	downloading = false;
-        }
-        return null;
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java
deleted file mode 100644
index 2d5fdea8ad00f43bd4d6a19e8b1980afa53d00f6..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java
+++ /dev/null
@@ -1,59 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpPagePostsAction extends HttpUIAction {
-	BrowseConfig config;
-	List<ForumPostConfig> posts;
-
-	public HttpPagePostsAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.posts = MainAbility.connection.getPosts(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.posts = this.posts;
-		MainAbility.browsePosts = this.config;
-//        ((BrowsePostAbility)this.ability).instances = this.posts;
-//        ((BrowsePostAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java
deleted file mode 100644
index c8b6665c06a055ea9b1bd3a3c68cfd635fd63fcc..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java
+++ /dev/null
@@ -1,55 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BotModeConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveChannelBotModeAction extends HttpUIAction {
-
-	BotModeConfig config;
-	
-	public HttpSaveChannelBotModeAction(Ability Ability, BotModeConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.saveChannelBotMode(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.botMode = this.config;
-		
-		this.ability.terminateAbility();
-    }
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java
deleted file mode 100644
index 1e8b761a241003d8c0f132817940ac94fe6913ef..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java
+++ /dev/null
@@ -1,55 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.LearningConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveLearningAction extends HttpUIAction {
-
-	LearningConfig config;
-	
-	public HttpSaveLearningAction(Ability Ability, LearningConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.saveLearning(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.learning = this.config;
-		
-		this.ability.terminateAbility();
-    }
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java
deleted file mode 100644
index e075572af1516334f9c6aac798a261e712b7361d..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java
+++ /dev/null
@@ -1,62 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ResponseConfig;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveResponseAction extends HttpUIAction {
-
-	public ResponseConfig config;
-	public static ResponseConfig response;
-	public static ResponseConfig oldResponse;
-	
-	public HttpSaveResponseAction(Ability Ability, ResponseConfig config) {
-		super(Ability);
-		this.config = config;
-		oldResponse = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.saveResponse(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		if (this.ability instanceof TrainingAbility) {
-//			((TrainingAbility)this.ability).resetView(this.config);
-//		} else {
-//			response = this.config;
-//			this.ability.terminateAbility();
-//		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java
deleted file mode 100644
index 9c636ff8ab32cb8be007c0e09b2319c60bbb7fbc..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java
+++ /dev/null
@@ -1,56 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveScriptSourceAction extends HttpUIAction {
-	
-	ScriptSourceConfig config;
-
-	public HttpSaveScriptSourceAction(Ability Ability, ScriptSourceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveScriptSource(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.script = this.config;
-		
-		this.ability.terminateAbility();
-	}
-
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java
deleted file mode 100644
index 8d06013cea0c233e4b17f01bb3fb03260a3b6de7..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpStarIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpStarIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.star(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.issue.stars = config.stars;
-//	    ((IssueAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java
deleted file mode 100644
index 78dd4d46c6e5158d26570ee9bf76e3096f906b2c..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSubscribeIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpSubscribeIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.subscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java
deleted file mode 100644
index b030c09091b9bc65b168e203d139a5b621c96ecc..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsUpAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpThumbsUpAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsUp(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.instance.thumbsUp++;
-//	    ((WebMediumAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java
deleted file mode 100644
index 0c34c41412887316a1229c8c9190268a3c160ce3..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsUpIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpThumbsUpIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsUp(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.issue.thumbsUp++;
-//	    ((IssueAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java
deleted file mode 100644
index a843d0794353081e9ad62d22b70c06a53f0825d9..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java
+++ /dev/null
@@ -1,55 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsUpPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpThumbsUpPostAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsUp(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.post.thumbsUp++;
-//	    ((ForumPostAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java
deleted file mode 100644
index 938262e5f1cdd51b81a07b885856a86257a2b382..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUnsubscribeAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpUnsubscribeAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.unsubscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java
deleted file mode 100644
index 9d456711443e3bfd3b84c96a1eb8d04098a2c05c..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java
+++ /dev/null
@@ -1,56 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpBotScriptAction extends HttpUIAction {
-	
-	ScriptSourceConfig config;
-
-	public HttpUpBotScriptAction(Ability Ability, ScriptSourceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.upBotScript(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.script = this.config;
-		
-//	   ((BotScriptsAbility)this.ability).resetView();
-
-	}
-
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java
deleted file mode 100644
index 2374b85e68a40b26560ca137f780c2ec40d12af3..0000000000000000000000000000000000000000
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpdateIssueAction extends HttpUIAction {
-
-	IssueConfig config;
-
-	public HttpUpdateIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.update(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.issue = this.config;
-			
-			this.ability.terminateAbility();
-			
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
index 275ea4125ece92822879c086888206de39df99bb..b2c8052f5f46643001184499e517b466d1496cd2 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
@@ -197,9 +197,15 @@ public class AvatarConfig extends WebMediumConfig {
 	public void parseXML(Element element) {
 		super.parseXML(element);
 	}
-	
+
 	/**
 	 * Find any media that match the emotion, action, and pose, or the best matches.
+	 *
+	 * @param emotion emotion
+	 * @param action action
+	 * @param pose pose
+	 * @param pose2 pose2
+	 * @return
 	 */
 	public List<AvatarMedia> getMedia(String emotion, String action, String pose, String pose2) {
 		if (emotion == null || emotion.isEmpty()) {
@@ -461,9 +467,13 @@ public class AvatarConfig extends WebMediumConfig {
 		}
 		return matches;
 	}
-	
+
 	/**
 	 * Find an audio media that matches the action or pose.
+	 *
+	 * @param action action
+	 * @param pose pose
+	 * @return getAudio
 	 */
 	public List<AvatarMedia> getAudio(String action, String pose) {
 		if (action == null) {
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
index a1b9b74dea95e217b4796f98f0bd08244835032d..5c8e4d83fc0b8525af07dec03f739936e6d02f8f 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
@@ -1,7 +1,7 @@
 package org.botlibre.sdk.micro;
 
 import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.actions.HttpUIAction;
+import org.botlibre.sdk.ability.actions.HttpUIAction;
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.ScriptConfig;
 import org.botlibre.sdk.config.ScriptSourceConfig;
@@ -171,6 +171,9 @@ public class BootstrapAsync extends HttpUIAction {
 
 	/**
 	 * Load, compile, and add the state machine from the Self source code.
+	 *
+	 * @param bot bot
+	 * @param text text
 	 */
 	public void loadSelf(Bot bot, String text) {
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
index 99f6becf8c7da40392c4bfa2c329e330a36842d3..d8c26ab63134370d42b0282926bcb658e56861f6 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
@@ -18,18 +18,12 @@
 
 package org.botlibre.sdk.micro;
 
-import java.io.File;
-import java.io.IOException;
-import java.io.InputStream;
 import java.net.URL;
 import java.util.HashMap;
 import java.util.Map;
 
 import org.botlibre.sdk.SDKConnection;
-import org.botlibre.sdk.SDKException;
 import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.ChatConfig;
-import org.botlibre.sdk.config.ChatResponse;
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.VoiceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
@@ -43,7 +37,6 @@ import org.botlibre.knowledge.micro.MicroMemory;
 import org.botlibre.self.SelfCompiler;
 import org.botlibre.sense.http.Wiktionary;
 import org.botlibre.sense.text.TextEntry;
-import org.botlibre.sense.text.TextInput;
 import org.botlibre.sense.text.TextListener;
 import org.botlibre.sense.text.TextOutput;
 import org.botlibre.thought.consciousness.Consciousness;
@@ -72,6 +65,8 @@ public class MicroConnection extends SDKConnection implements TextListener {
 	/**
 	 * Create a micro/offline SDK connection.
 	 * Use the credentials to enable online support.
+	 *
+	 * @param credentials credentials
 	 */
 	public MicroConnection(Credentials credentials) {
 		this.credentials = credentials;
@@ -90,70 +85,12 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		return bot;
 	}
 
-	/**
-	 * Process the bot chat message and return the bot's response.
-	 * The ChatConfig should contain the conversation id if part of a conversation.
-	 * If a new conversation the conversation id is returned in the response. 
-	 */
-	public synchronized ChatResponse chat(ChatConfig config) {
-		if (config.instance == null) {
-			config.instance = "default";
-		}
-		// this method will return a Bot with the default instance
-		Bot bot = getBot(this.config.id);
-		try {
-			int i = 0;
-			while (i <= 4) {
-				if (bot == null) {
-					wait(1000);
-					bot = this.activeBots.get(config.instance);
-				} else if (bot != null) {
-					break;
-				}
-				i++;
-			}
-		} catch (Exception e) {}
-
-		if (bot == null) {
-			this.exception = new SDKException("Bot doesn't exists!");
-			throw this.exception;
-		}
-
-		TextEntry sense = bot.awareness().getSense(TextEntry.class);
-		// setting the user admin for the BOT.
-		sense.setUser(reInitialize(bot));
-		bot.setFilterProfanity(false);
-
-		sense.setTextListener(this);
-		this.message = null;
-		TextInput textInput = new TextInput(config.message);
-		textInput.setCorrection(config.correction);
-		textInput.setOffended(config.offensive);
-
-		sense.input(textInput);
-		ChatResponse response = new ChatResponse();
-
-		try {
-			if (this.message == null) {
-				wait(5000);
-			}
-			if (this.message != null) {
-				response.message = this.message.getMessage();
-				response.command = bot.avatar().getCommand();
-				try {
-					avatarConfig.chatReply(response);
-				} catch (Exception e) {
-				}
-			}
-		} catch (InterruptedException exception) {
-			this.exception = new SDKException("Timeout waiting for response");
-			throw this.exception;
-		}
-		return response;
-	}
-	
 	/**
 	 * Fetch the local object.
+	 *
+	 * @param config config
+	 * @param <T> <T>
+	 * @return Fetch the local object
 	 */
 	public <T extends WebMediumConfig> T fetch(T config) {
 		this.config = config;
@@ -166,9 +103,12 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		}
 		return config;
 	}
-	
+
 	/**
 	 * Return the bot's voice configuration.
+	 *
+	 * @param config config
+	 * @return Return the bot's voice configuration.
 	 */
 	public VoiceConfig getVoice(InstanceConfig config) {
 		VoiceConfig voice = new VoiceConfig();
@@ -176,13 +116,25 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		voice.language = "en";
 		return voice;
 	}
-	
+
+	/**
+	 * sendMessage
+	 *
+	 * @param message sendMessage
+	 */
 	public synchronized void sendMessage(TextOutput message) {
 		this.message = message;
 		notifyAll();
 	}
-	
-	public synchronized Bot loadBot(String name, int id) {
+
+	/**
+	 * loadBot
+	 *
+	 * @param name name
+	 * @param id id
+	 * @return loadBot
+	 */
+	public Bot loadBot(String name, int id) {
 		boolean exists = MicroMemory.checkExists();
 		Bot.CONFIG_FILE = "config.xml";
 		Bot bot = Bot.createInstance(Bot.CONFIG_FILE, name, true);
@@ -213,24 +165,34 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		}
 		return bot;
 	}
-	
-	public void loadAIMLScript(Language lang,InputStream source){
-		lang.loadAIMLFile(source, config.id, false, false, true,"",10000000);
-	}
-	
+
+	/**
+	 * loadResScript
+	 *
+	 * @param bot bot
+	 * @param fileName fileName
+	 */
 	public void loadResScript(Bot bot, String fileName) {
 		URL url = getClass().getResource(fileName);
 		bot.awareness().getSense(TextEntry.class).loadChatFile(url, "Response List", "", false, true);
 	}
 
-	public void loadResScript(Bot bot, File file) {
-		bot.awareness().getSense(TextEntry.class).loadChatFile(file, "Response List", "", false, true);
-	}
-	
+	/**
+	 * loadSelfScript
+	 *
+	 * @param bot bot
+	 * @param fileName fileName
+	 */
 	public void loadSelfScript(Bot bot, String fileName) {
 		loadSelfScript(bot, getClass().getResource(fileName));
 	}
 
+	/**
+	 * loadSelfScript
+	 *
+	 * @param bot bot
+	 * @param url url
+	 */
 	public void loadSelfScript(Bot bot, URL url) {
 		Network network = bot.memory().getShortTermMemory();
 		Vertex language = network.createVertex(new Primitive(Language.class.getName()));
@@ -239,36 +201,4 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		language.addRelationship(Primitive.STATE, stateMachine);
 		SelfCompiler.getCompiler().pin(stateMachine);
 	}
-
-	public void loadSelfScript(Bot bot, File file) {
-		Network network = bot.memory().getShortTermMemory();
-		Vertex language = network.createVertex(new Primitive(Language.class.getName()));
-		SelfCompiler compiler = SelfCompiler.getCompiler();
-		Vertex stateMachine = compiler.parseStateMachine(file, "", false, network);
-		language.addRelationship(Primitive.STATE, stateMachine);
-		SelfCompiler.getCompiler().pin(stateMachine);
-	}
-	
-	public void renameMemory(Bot bot, String name) {
-		bot.memory().getShortTermMemory().createVertex(Primitive.SELF).addRelationship(Primitive.NAME, bot.memory().getShortTermMemory().createVertex(name));
-		
-	}
-	
-	public Vertex reInitialize(Bot bot) {
-		Network memory = bot.memory().newMemory();
-		Vertex user = memory.createSpeaker("Admin");
-		user.addRelationship(Primitive.ASSOCIATE, Primitive.ADMINISTRATOR);
-		memory.save();
-		return user;
-	}
-	
-	public static void copyStream(InputStream input) throws IOException {
-//		FileOutputStream output = MainAbility.current.openFileOutput(MicroMemory.storageFileName,
-//				Ability.MODE_PRIVATE);
-//		byte[] buffer = new byte[1024]; // Adjust if you want
-//		int bytesRead;
-//		while ((bytesRead = input.read(buffer)) != -1) {
-//			output.write(buffer, 0, bytesRead);
-//		}
-	}
 }
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
index 66d558f2128ec4a3b619ba4abaaa29680b0d1c29..c364cd21a4ddf239d018cdfbcd6da41d51807e50 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
@@ -1,10 +1,7 @@
 package org.botlibre.sdk.provider;
 
-import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.SDKConnection;
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.activityy.actions.HttpGetImageAction;
+import org.botlibre.sdk.ability.ChatAbility;
 import org.botlibre.sdk.config.ChatConfig;
 import org.botlibre.sdk.config.ChatResponse;
 import ohos.aafwk.ability.Ability;
@@ -53,24 +50,10 @@ public class ChatListProvicer extends BaseItemProvider {
         if (message instanceof ChatConfig) {
             ChatConfig config = (ChatConfig) message;
             messageView.setText(config.message);
-            if (MainAbility.user != null && MainAbility.user.avatar != null) {
-                if (MainAbility.online) {
-                    HttpGetImageAction.fetchImage(slice, MainAbility.user.avatar, userView);
-                } else {
-                    HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, userView);
-                }
-            } else {
-                HttpGetImageAction.fetchImage(slice, SDKConnection.defaultUserImage(), userView);
-            }
         } else if (message instanceof ChatResponse) {
             ChatResponse config = (ChatResponse) message;
             messageView.setText(Utils.stripTags(config.message));
             String avatar = ((ChatAbility) this.slice).getAvatarIcon(config);
-            if (MainAbility.online) {
-                HttpGetImageAction.fetchImage(slice, avatar, userView);
-            } else {
-                HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, userView);
-            }
         }
 
         return cpt;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/util/Utils.java b/BotLibre/entry/src/main/java/org/botlibre/sdk/util/Utils.java
index e2667554458cf4b39b09db6f45618ae95b08168b..70462fcc327c7c2c6db32a63dd2248dd0cf83e78 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/util/Utils.java
+++ b/BotLibre/entry/src/main/java/org/botlibre/sdk/util/Utils.java
@@ -18,14 +18,8 @@
 
 package org.botlibre.sdk.util;
 
-import org.botlibre.BotException;
-
-import java.io.IOException;
-import java.io.InputStream;
-import java.io.InputStreamReader;
 import java.io.StringWriter;
 import java.util.Calendar;
-import java.util.Collection;
 import java.util.Date;
 import java.util.List;
 import java.util.Locale;
@@ -45,8 +39,10 @@ public class Utils {
 	public static Pattern emailRegex = Pattern.compile("(([a-zA-Z0-9_\\-\\.]+)@[a-zA-Z_]+?(?:\\.[a-zA-Z]{2,6}))+", Pattern.CASE_INSENSITIVE);
 	
 	/**
-	 * Replace links with HTML links.
 	 * Includes http, www, images, video, audio, email address.
+	 *
+	 * @param text text
+	 * @return Includes http, www, images, video, audio, email address.
 	 */
 	public static String linkHTML(String text) {
 		if (text == null || text.length() == 0) {
@@ -102,10 +98,13 @@ public class Utils {
 		}
 		return text;
 	}
-	
+
 
 	/**
 	 * Replace reserved HTML character with their HTML escape codes.
+	 *
+	 * @param html html
+	 * @return Replace reserved HTML character with their HTML escape codes.
 	 */
 	public static String escapeHTML(String html) {
 		return html.replace("&", "&amp;")
@@ -118,6 +117,9 @@ public class Utils {
 
 	/**
 	 * Strip the HTML tags from the text.
+	 *
+	 * @param html html
+	 * @return Strip the HTML tags from the text.
 	 */
 	public static String stripTags(String html) {
 		if (html == null) {
@@ -165,187 +167,11 @@ public class Utils {
 	}
 
 	/**
-	 * Format the text that may be HTML, or may be text, or markup, or a mix.
+	 * displayTimestamp
+	 *
+	 * @param date date
+	 * @return displayTimestamp
 	 */
-	public static String formatHTMLOutput(String text) {
-		if (text == null) {
-			return "";
-		}
-		int index = text.indexOf('<');
-		int index2 = text.indexOf('>');
-		boolean isHTML = (index != -1) && (index2 > index);
-		boolean isMixed = isHTML && text.contains("[code]");
-		if (isHTML && !isMixed) {
-			return text;
-		}
-		if (!isMixed && ((index != -1) || (index2 != -1))) {
-			text = text.replace("<", "&lt;");
-			text = text.replace(">", "&gt;");
-		}
-		TextStream stream = new TextStream(text);
-		StringWriter writer = new StringWriter();
-		boolean bullet = false;
-		boolean nbullet = false;
-		while (!stream.atEnd()) {
-			String line = stream.nextLine();
-			if (!isMixed && (line.contains("http://") || line.contains("https://"))) {
-				line = Utils.linkHTML(line);
-			}
-			TextStream lineStream = new TextStream(line);
-			boolean firstWord = true;
-			boolean span = false;
-			boolean cr = true;
-			while (!lineStream.atEnd()) {
-				while (!isMixed && firstWord && lineStream.peek() == ' ') {
-					lineStream.next();
-					writer.write("&nbsp;");
-				}
-				String whitespace = lineStream.nextWhitespace();
-				writer.write(whitespace);
-				if (lineStream.atEnd()) {
-					break;
-				}
-				String word = lineStream.nextWord();
-				if (!isMixed && nbullet && firstWord && !word.equals("#")) {
-					writer.write("</ol>\n");
-					nbullet = false;
-				} else if (!isMixed && bullet && firstWord && !word.equals("*")) {
-					writer.write("</ul>\n");
-					bullet = false;
-				}
-				if (firstWord && word.equals("[")) {
-					String peek = lineStream.peekWord();
-					if ("code".equals(peek)) {
-						lineStream.nextWord();
-						String next = lineStream.nextWord();
-						String lang = "javascript";
-						int lines = 20;
-						if ("lang".equals(next)) {
-							lineStream.skip();
-							lang = lineStream.nextWord();
-							if ("\"".equals(lang)) {
-								lang = lineStream.nextWord();
-								lineStream.skip();
-							}
-							next = lineStream.nextWord();
-						}
-						if ("lines".equals(next)) {
-							lineStream.skip();
-							String value = lineStream.nextWord();
-							if ("\"".equals(value)) {
-								value = lineStream.nextWord();
-								lineStream.skip();
-							}
-							lineStream.skip();
-							try {
-								lines = Integer.valueOf(value);
-							} catch (NumberFormatException ignore) {}
-						}
-						String id = "code" + stream.getPosition();
-						writer.write("<div style=\"width:100%;height:" + lines * 14 + "px;max-width:none\" id=\"" + id + "\">");
-						String code = lineStream.upToAll("[code]");
-						if (code.indexOf('<') != -1) {
-							code = code.replace("<", "&lt;");
-						}
-						if (code.indexOf('>') != -1) {
-							code = code.replace(">", "&gt;");
-						}
-						writer.write(code);
-						while (lineStream.atEnd() && !stream.atEnd()) {
-							line = stream.nextLine();
-							lineStream = new TextStream(line);
-							while (lineStream.peek() == ':') {
-								lineStream.next();
-								writer.write("&nbsp;&nbsp;&nbsp;&nbsp;");								
-							}
-							code = lineStream.upToAll("[code]");
-							if (code.indexOf('<') != -1) {
-								code = code.replace("<", "&lt;");
-							}
-							if (code.indexOf('>') != -1) {
-								code = code.replace(">", "&gt;");
-							}
-							writer.write(code);
-						}
-						lineStream.skip("[code]".length());
-						writer.write("</div>\n");
-
-						writer.write("<script>\n");
-						writer.write("var " + id + " = ace.edit('" + id + "');\n");
-						writer.write(id + ".getSession().setMode('ace/mode/" + lang + "');\n");
-						writer.write(id + ".setReadOnly(true);\n");
-						writer.write("</script>\n");
-					} else {
-						writer.write(word);
-					}
-				} else if (!isMixed && firstWord && word.equals("=")) {
-					int count = 2;
-					String token = word;
-					while (!lineStream.atEnd() && lineStream.peek() == '=') {
-						lineStream.skip();
-						count++;
-						token = token + "=";
-					}
-					String header = lineStream.upToAll(token);
-					if (lineStream.atEnd()) {
-						writer.write(token);
-						writer.write(header);
-					} else {
-						lineStream.skip(token.length());
-						writer.write("<h");
-						writer.write(String.valueOf(count));
-						writer.write(">");
-						writer.write(header);
-						writer.write("</h");
-						writer.write(String.valueOf(count));
-						writer.write(">");
-						cr = false;
-					}
-				} else if (!isMixed && firstWord && word.equals(":")) {
-					span = true;
-					int indent = 1;
-					while (!lineStream.atEnd() && lineStream.peek() == ':') {
-						lineStream.skip();				
-						indent++;
-					}
-					writer.write("<span style=\"display:inline-block;text-indent:");
-					writer.write(String.valueOf(indent * 20));
-					writer.write("px;\">");	
-				} else if (!isMixed && firstWord && word.equals("*")) {
-					if (!bullet) {
-						writer.write("<ul>");
-						bullet = true;
-					}
-					writer.write("<li>");
-					cr = false;
-				} else if (!isMixed && firstWord && word.equals("#")) {
-					if (!nbullet) {
-						writer.write("<ol>");
-						nbullet = true;
-					}
-					writer.write("<li>");
-					cr = false;
-				} else {
-					writer.write(word);
-				}
-				firstWord = false;
-			}
-			if (!isMixed && span) {
-				writer.write("</span>");
-			}
-			if (!isMixed && cr) { 
-				writer.write("<br/>\n");
-			}
-		}
-		if (!isMixed && bullet) {
-			writer.write("</ul>");
-		}
-		if (!isMixed && nbullet) {
-			writer.write("</ol>");
-		}
-		return writer.toString();
-	}
-	
 	public static String displayTimestamp(Date date) {
 		if (date == null) {
 			return "";
@@ -379,7 +205,13 @@ public class Utils {
 		
 		return writer.toString();
 	}
-	
+
+	/**
+	 * displayTime
+	 *
+	 * @param date date
+	 * @return displayTime
+	 */
 	public static String displayTime(Date date) {
 		if (date == null) {
 			return "";
@@ -401,7 +233,13 @@ public class Utils {
 		
 		return writer.toString();
 	}
-	
+
+	/**
+	 * displayDate
+	 *
+	 * @param date date
+	 * @return displayDate
+	 */
 	public static String displayDate(Date date) {
 		if (date == null) {
 			return "";
@@ -428,9 +266,12 @@ public class Utils {
 		
 		return writer.toString();
 	}
-	
+
 	/**
 	 * Capitalize the first character of the string.
+	 *
+	 * @param text text
+	 * @return Capitalize the first character of the string.
 	 */
 	public static String capitalize(String text) {
 		if (text.length() == 0) {
@@ -438,80 +279,4 @@ public class Utils {
 		}
 		return Character.toUpperCase(text.charAt(0)) + text.substring(1, text.length());
 	}
-	
-	public static Random random() {
-		return random;
-	}
-	
-	public static int random(int max) {
-		return random().nextInt(max);
-	}
-	
-	public static <T> T random(List<T> list) {
-		if ((list == null) || list.isEmpty()) {
-			return null;
-		}
-		return list.get(random().nextInt(list.size()));
-	}
-	/**
-	 * Get the contents of the stream to a .self file and parse it.
-	 */
-	public static String loadTextFile(InputStream stream, String encoding, int maxSize, boolean finish) {
-		if (encoding.trim().isEmpty()) {
-			encoding = "UTF-8";
-		}
-
-	    // FEFF because this is the Unicode char represented by the UTF-8 byte order mark (EF BB BF).
-	    String UTF8_BOM = "\uFEFF";
-	    
-		StringWriter writer = new StringWriter();
-		InputStreamReader reader = null;
-		try {
-			reader = new InputStreamReader(stream, encoding);
-			int size = 0;
-			int next = reader.read();
-			boolean first = true;
-			while (next >= 0) {
-				if (first && next == UTF8_BOM.charAt(0)) {
-					// skip
-				} else {
-					writer.write(next);
-				}
-				next = reader.read();
-				if (size > maxSize) {
-					throw new BotException("File size limit exceeded: " + size + " > " + maxSize + " token: " + next);
-				}
-				size++;
-			}
-		} catch (IOException exception) {
-			throw new BotException("IO Error: " + exception.getMessage(), exception);
-		} finally {
-			if (reader != null && finish) {
-				try {
-					reader.close();
-				} catch (IOException ignore) {}
-			}
-			if (stream != null && finish) {
-				try {
-					stream.close();
-				} catch (IOException ignore) {}
-			}
-		}
-		return writer.toString();
-	}
-	
-	public static <T> T random(Collection<T> collection) {
-		if ((collection == null) || collection.isEmpty()) {
-			return null;
-		}
-		int value = random().nextInt(collection.size());
-		int index = 0;
-		for (T element : collection) {
-			if (index == value) {
-				return element;				
-			}
-			index++;
-		}
-		return null;
-	}
 }
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/resources/base/layout/activity_chat.xml b/BotLibre/entry/src/main/resources/base/layout/ability_chat.xml
similarity index 99%
rename from BotLibre/entry/src/main/resources/base/layout/activity_chat.xml
rename to BotLibre/entry/src/main/resources/base/layout/ability_chat.xml
index c62ff63acfe676b3fae0889d109695c4f836bcff..a95efef03611e17b5b588986536c37ef20590afe 100644
--- a/BotLibre/entry/src/main/resources/base/layout/activity_chat.xml
+++ b/BotLibre/entry/src/main/resources/base/layout/ability_chat.xml
@@ -1,7 +1,7 @@
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/BotLibreOffline/CHANGELOG.md b/BotLibreOffline/CHANGELOG.md
index 8483416665be86ca1fdd9bdc9b355c61636f0fa6..bd8486c3dc641e4c777c96dc0b45df63caf70331 100644
--- a/BotLibreOffline/CHANGELOG.md
+++ b/BotLibreOffline/CHANGELOG.md
@@ -3,5 +3,5 @@ ohos 第二个版本，更新sdk6
 ## 0.0.1-SNAPSHOT
 ohos 第一个版本
  * 实现了原库的大部分api
- * 无法实现跳转邮箱功能
- * 软键盘关闭后无法恢复页面布局
\ No newline at end of file
+ * 鸿蒙的IntentConstants中没有跳转邮箱的action，故无法实现跳转邮箱功能
+ * 鸿蒙监听不到软键盘软键盘状态的改变，因此软键盘关闭后无法恢复页面布局
\ No newline at end of file
diff --git a/BotLibreOffline/README.md b/BotLibreOffline/README.md
index f76183e192b399c8d181bb636115b0564a130b50..bea39b4491edd773b0cdeeb40fe61321a613e4fc 100644
--- a/BotLibreOffline/README.md
+++ b/BotLibreOffline/README.md
@@ -5,10 +5,10 @@
 - 项目名称：BotLibre
 - 所属系列：OpenHarmony的第三方组件适配移植
 - 功能：人工智能、nlp、聊天机器人、虚拟代理、社交媒体自动化和实时聊天自动化的开源平台
-- 基线版本：master
 - 项目移植状态：主功能完成
 - 调用差异：无
 - 开发版本：sdk6，DevEco Studio2.2 Beta1
+- 基线版本：master
 
 ## 效果演示
 
@@ -23,7 +23,7 @@ Demo中调用library组件，然后通过五个功能操作展示组件。
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/BotLibreOffline/build.gradle b/BotLibreOffline/build.gradle
index f0fed48a4512412c40b615d22d70fe57bd5dec43..1391477569e49c6048fe4bb661522c0a6bbecf69 100644
--- a/BotLibreOffline/build.gradle
+++ b/BotLibreOffline/build.gradle
@@ -2,6 +2,17 @@
 apply plugin: 'com.huawei.ohos.app'
 
 ohos {
+    signingConfigs {
+        debug {
+            storeFile file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_890086000102149657.p12')
+            storePassword '000000183B47E4F223C889B1B209EC32F6804EDF29D1A9D427D6B0BAD0624BA26E5A50C55928D580'
+            keyAlias = 'debugKey'
+            keyPassword '00000018527B68117F359DCE45D73A849AD571D918A8D184211DA61CA0357EC72CD02DC10AD15294'
+            signAlg = 'SHA256withECDSA'
+            profile file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_sdk_890086000102149657.p7b')
+            certpath file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_890086000102149657.cer')
+        }
+    }
     compileSdkVersion 6
     defaultConfig {
         compatibleSdkVersion 5
diff --git a/BotLibreOffline/entry/build.gradle b/BotLibreOffline/entry/build.gradle
index b2ed823081a3b38ad6ba790435b3de4758924d79..355e0c3c531fc4344d282150e455e8251a121d92 100644
--- a/BotLibreOffline/entry/build.gradle
+++ b/BotLibreOffline/entry/build.gradle
@@ -34,6 +34,7 @@ dependencies {
     implementation('com.gitee.chinasoft_ohos:Zloading:0.0.1-SNAPSHOT')
     implementation 'io.openharmony.tpc.thirdlib:PersistentCookieJar:1.0.1'
     implementation 'io.openharmony.tpc.thirdlib:mp3recorderlib:1.0.0'
+    implementation 'com.gitee.chinasoft_ohos:EmailIntentBuilder:0.0.2-SNAPSHOT'
 }
 decc {
     supportType = ['html', 'xml']
diff --git a/BotLibreOffline/entry/src/main/config.json b/BotLibreOffline/entry/src/main/config.json
index 2942baa6deb667764dca01ffe2c862120c1d5f08..9eeb695e15c72900f6333f07d7b68a97379aaa7b 100644
--- a/BotLibreOffline/entry/src/main/config.json
+++ b/BotLibreOffline/entry/src/main/config.json
@@ -40,73 +40,73 @@
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.avatar.AvatarSelection",
+        "name": "org.botlibre.sdk.ability.avatar.AvatarSelection",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.LoginAbility",
+        "name": "org.botlibre.sdk.ability.LoginAbility",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.CreateUserAbility",
+        "name": "org.botlibre.sdk.ability.CreateUserAbility",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.ChatAbility",
+        "name": "org.botlibre.sdk.ability.ChatAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.ChatAbility2",
+        "name": "org.botlibre.sdk.ability.ChatAbility2",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.war.StartWarAbility",
+        "name": "org.botlibre.sdk.ability.war.StartWarAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.LibreAbility",
+        "name": "org.botlibre.sdk.ability.LibreAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.BotSearchAbility",
+        "name": "org.botlibre.sdk.ability.BotSearchAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.SearchAbility",
+        "name": "org.botlibre.sdk.ability.SearchAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.HelpAbility",
+        "name": "org.botlibre.sdk.ability.HelpAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.ListTemplateView",
+        "name": "org.botlibre.sdk.ability.ListTemplateView",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.CreateWebMediumAbility",
+        "name": "org.botlibre.sdk.ability.CreateWebMediumAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.MicConfigAbility",
+        "name": "org.botlibre.sdk.ability.MicConfigAbility",
         "description": "",
         "type": "page"
       }
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/Bot.java b/BotLibreOffline/entry/src/main/java/org/botlibre/Bot.java
deleted file mode 100644
index 653a6161276898c3bab7a12da0a1931051ac92ab..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/Bot.java
+++ /dev/null
@@ -1,705 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-package org.botlibre;
-
-import org.botlibre.sdk.MyApplication;
-import ohos.global.resource.RawFileEntry;
-import ohos.global.resource.ResourceManager;
-import org.botlibre.api.avatar.Avatar;
-import org.botlibre.api.emotion.Emotion;
-import org.botlibre.api.emotion.Mood;
-import org.botlibre.api.knowledge.Memory;
-import org.botlibre.api.sense.Awareness;
-import org.botlibre.api.sense.Sense;
-import org.botlibre.api.sense.Tool;
-import org.botlibre.api.thought.Mind;
-import org.botlibre.api.thought.Thought;
-import org.botlibre.util.Utils;
-import org.w3c.dom.Document;
-import org.w3c.dom.Element;
-import org.w3c.dom.NodeList;
-
-import javax.xml.parsers.DocumentBuilder;
-import javax.xml.parsers.DocumentBuilderFactory;
-import java.io.PrintWriter;
-import java.io.StringWriter;
-import java.util.HashMap;
-import java.util.HashSet;
-import java.util.Iterator;
-import java.util.Map;
-import java.util.Queue;
-import java.util.Set;
-import java.util.concurrent.ConcurrentHashMap;
-import java.util.concurrent.ConcurrentLinkedQueue;
-import java.util.concurrent.ConcurrentMap;
-import java.util.logging.Level;
-
-/**
- * This class represents the identity of a bot,
- * and controls module registration, startup and shutdown.
- * It defines a singleton that represents the system.
- */
-
-public class Bot {
-    public static String PROGRAM = "Bot";
-    public static String VERSION = "4.0.2 - 2016-02-29";
-
-    public static final Level FINE = Level.FINE;
-    public static final Level WARNING = Level.WARNING;
-    public static Level DEFAULT_DEBUG_LEVEL = Level.INFO;
-    public static final Level[] LEVELS = {Level.OFF, Level.SEVERE, Level.WARNING, Level.INFO, Level.CONFIG, Level.FINE, Level.FINER, Level.FINEST, Level.ALL};
-
-    public static String CONFIG_FILE = "config.xml";
-    public static int MAX_CACHE = 100000;
-    public static int MIN_CACHE = 10000;
-    public static int POOL_SIZE = 20;
-    private static ConcurrentMap<String, Bot> instances = new ConcurrentHashMap<String, Bot>();
-    private static Queue<String> instancesQueue = new ConcurrentLinkedQueue<String>();
-
-    public static Bot systemCache;
-
-    public Bot parent;
-
-    private Memory memory;
-    private Mind mind;
-    private Mood mood;
-    private Avatar avatar;
-    private Awareness awareness;
-    private boolean filterProfanity = true;
-    private String name;
-    private ActiveState state = ActiveState.INIT;
-
-    public enum ActiveState {INIT, ACTIVE, POOLED, SHUTDOWN}
-
-    private Set<LogListener> logListeners = new HashSet<LogListener>();
-    private Level debugLevel = DEFAULT_DEBUG_LEVEL;
-    private Stats stats;
-
-    public static Bot getSystemCache() {
-        return systemCache;
-    }
-
-    public static void setSystemCache(Bot systemCache) {
-        Bot.systemCache = systemCache;
-    }
-
-    public static Bot createInstance() {
-        return createInstance(CONFIG_FILE, "", false);
-    }
-
-    public static Bot createInstance(String configFile, String memory, boolean isSchema) {
-        Bot Bot = new Bot();
-        Bot.parseConfigFile(configFile);
-        Bot.setState(ActiveState.ACTIVE);
-        Bot.log(Bot, "Creating instance:", Level.INFO, configFile, memory, isSchema);
-        Bot.memory().restore(memory, isSchema);
-        Bot.memory().awake();
-        Bot.mind().awake();
-        Bot.mood().awake();
-        Bot.avatar().awake();
-        Bot.awareness().awake();
-        return Bot;
-    }
-
-    public static Bot fastCreateInstance(String configFile, String memory, boolean isSchema) {
-        Bot bot = new Bot();
-        long start = System.currentTimeMillis();
-        bot.parseConfigFile(configFile);
-        long time = System.currentTimeMillis() - start;
-        if (time > 500) {
-            System.out.println("Connect parseConfigFile time: " + time);
-        }
-        bot.setState(ActiveState.ACTIVE);
-        bot.log(bot, "Fast creating instance:", Level.INFO, configFile, memory, isSchema);
-        start = System.currentTimeMillis();
-        bot.memory().fastRestore(memory, isSchema);
-        time = System.currentTimeMillis() - start;
-        if (time > 500) {
-            System.out.println("Connect fastRestore time: " + time);
-        }
-        start = System.currentTimeMillis();
-        bot.memory().awake();
-        bot.mind().awake();
-        bot.mood().awake();
-        bot.avatar().awake();
-        bot.awareness().awake();
-        time = System.currentTimeMillis() - start;
-        if (time > 500) {
-            System.out.println("Connect awake time: " + time);
-        }
-        return bot;
-    }
-
-    /**
-     * Return the cached instance from the pool if available, otherwise create a new instance.
-     */
-    public static Bot createInstanceFromPool(String instanceName, boolean isSchema) {
-        Bot instance = instances.remove(instanceName);
-        if (instance != null) {
-            instancesQueue.remove(instanceName);
-            if (instance.getState() != ActiveState.POOLED) {
-                instance.log(instance, "Invalid instance in pool", Level.INFO);
-                instance = null;
-            } else {
-                instance.setState(ActiveState.ACTIVE);
-                instance.log(instance, "Creating instance from pool, cache size:", Level.INFO, instanceName, instance.memory().cacheSize());
-            }
-        }
-        if (instance == null) {
-            //instance =  createInstance(CONFIG_FILE, instanceName);
-            long start = System.currentTimeMillis();
-            instance = fastCreateInstance(CONFIG_FILE, instanceName, isSchema);
-            long time = System.currentTimeMillis() - start;
-            instance.log(instance, "Creating new instance, time, cache size:", Level.INFO, instanceName, time, instance.memory().cacheSize());
-        }
-        return instance;
-    }
-
-    public Bot() {
-        this.parent = systemCache;
-    }
-
-    /**
-     * Raise the statistic event.
-     */
-    public void stat(String stat) {
-        if (this.stats != null) {
-            this.stats.stat(stat);
-            ;
-        }
-    }
-
-    public Stats getStats() {
-        return stats;
-    }
-
-    public void setStats(Stats stats) {
-        this.stats = stats;
-    }
-
-    public ActiveState getState() {
-        return state;
-    }
-
-    public void setState(ActiveState state) {
-        this.state = state;
-    }
-
-    public Bot getParent() {
-        return parent;
-    }
-
-    public void setParent(Bot parent) {
-        this.parent = parent;
-    }
-
-    public boolean getFilterProfanity() {
-        return filterProfanity;
-    }
-
-    public void setFilterProfanity(boolean filterProfanity) {
-        this.filterProfanity = filterProfanity;
-    }
-
-    /**
-     * Return the debugging level.
-     */
-    public Level getDebugLevel() {
-        return this.debugLevel;
-    }
-
-    public boolean isDebug() {
-        return this.debugLevel.intValue() < Level.OFF.intValue();
-    }
-
-    public boolean isDebugFine() {
-        return this.debugLevel.intValue() <= Level.FINE.intValue();
-    }
-
-    public boolean isDebugFiner() {
-        return this.debugLevel.intValue() <= Level.FINER.intValue();
-    }
-
-    public boolean isDebugFinest() {
-        return this.debugLevel.intValue() <= Level.FINEST.intValue();
-    }
-
-    public boolean isDebugWarning() {
-        return this.debugLevel.intValue() <= Level.WARNING.intValue();
-    }
-
-    public boolean isDebugSever() {
-        return this.debugLevel.intValue() <= Level.SEVERE.intValue();
-    }
-
-    /**
-     * Log the message if the debug level is greater or equal to the level.
-     */
-    public void log(Object source, String message, Level level, Object... arguments) {
-        try {
-            if (this.debugLevel.intValue() <= level.intValue()) {
-                for (LogListener listener : getLogListeners()) {
-                    listener.log(source, message, level, arguments);
-                }
-                StringWriter writer = new StringWriter();
-                writer.write(level + ": " + getName()
-                        + " - " + Thread.currentThread()
-                        + " -- " + source + ":" + message);
-                for (Object argument : arguments) {
-                    writer.write(" - " + argument);
-                }
-                System.out.println(writer.toString());
-            }
-        } catch (Exception exception) {
-            System.out.println(exception);
-        }
-    }
-
-    /**
-     * Log the message if the debug level is greater or equal to the level.
-     *
-     public void log(Object source, String message, int level) {
-     log(source, message, int level);
-     }*/
-
-    /**
-     * Log the exception.
-     */
-    public void log(Object source, Throwable error) {
-        try {
-            if (isDebug()) {
-                for (LogListener listener : getLogListeners()) {
-                    listener.log(error);
-                }
-                log(source, error.getMessage(), WARNING);
-                if (!(error instanceof BotException)) {
-                    error.printStackTrace();
-                    StringWriter writer = new StringWriter();
-                    PrintWriter printer = new PrintWriter(writer);
-                    error.printStackTrace(printer);
-                    printer.flush();
-                    String stack = writer.toString();
-                    log(source, stack.substring(0, Math.max(100, stack.length() - 1)), Level.WARNING);
-                }
-            }
-        } catch (Exception exception) {
-            System.out.println(exception);
-        }
-    }
-
-    /**
-     * Set the debugging level.
-     */
-    public void setDebugLevel(Level level) {
-        this.debugLevel = level;
-        for (LogListener listener : getLogListeners()) {
-            listener.logLevelChange(level);
-        }
-    }
-
-    /**
-     * Return the awareness.
-     * The awareness defines the senses.
-     */
-    public Awareness awareness() {
-        return awareness;
-    }
-
-    /**
-     * Set the awareness.
-     * The awareness defines the senses.
-     */
-    public void setAwareness(Awareness awareness) {
-        awareness.setBot(this);
-        this.awareness = awareness;
-    }
-
-    /**
-     * Return the mind.
-     * The mind defines the thoughts.
-     */
-    public Mind mind() {
-        return mind;
-    }
-
-    /**
-     * Return the mood.
-     * The mood defines emotional states.
-     */
-    public Mood mood() {
-        return mood;
-    }
-
-    /**
-     * Return the Avatar.
-     * The Avatar expresses the emotional states.
-     */
-    public Avatar avatar() {
-        return avatar;
-    }
-
-    /**
-     * Set the mind.
-     * The mind defines the thoughts.
-     */
-    public void setMind(Mind mind) {
-        mind.setBot(this);
-        this.mind = mind;
-    }
-
-    /**
-     * Set the mood.
-     * The mood defines emotional states.
-     */
-    public void setMood(Mood mood) {
-        mood.setBot(this);
-        this.mood = mood;
-    }
-
-    /**
-     * Set the Avatar.
-     * The Avatar expresses the emotional state.
-     */
-    public void setAvatar(Avatar avatar) {
-        avatar.setBot(this);
-        this.avatar = avatar;
-    }
-
-    /**
-     * Return the memory.
-     * The memory defines the knowledge networks.
-     */
-    public Memory memory() {
-        return memory;
-    }
-
-    /**
-     * Set the memory.
-     * The memory defines the knowledge networks.
-     */
-    public void setMemory(Memory memory) {
-        memory.setBot(this);
-        this.memory = memory;
-    }
-
-    /**
-     * Return a Map of the property elements.
-     */
-    protected Map<String, Object> getProperties(Element element) {
-        NodeList properties = element.getElementsByTagName("property");
-        Map<String, Object> propertyValues = new HashMap<String, Object>();
-        for (int index = 0; index < properties.getLength(); index++) {
-            Element property = (Element) properties.item(index);
-            propertyValues.put(property.getAttribute("name"), property.getAttribute("value"));
-        }
-        return propertyValues;
-    }
-
-    /**
-     * Parses the config.xml files using the xerces xml dom parser.
-     * Loads the module implementors into the Bot system.
-     */
-    @SuppressWarnings("unchecked")
-    protected void parseConfigFile(String configFile) {
-        // Read config xml to initialize plugins.
-        try {
-            DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance();
-            DocumentBuilder parser = factory.newDocumentBuilder();
-
-            ResourceManager resManager = MyApplication.getAppContext().getResourceManager();
-            RawFileEntry rawFile = resManager.getRawFileEntry("resources/rawfile/config.xml");
-            Document document = parser.parse(rawFile.openRawFile());
-            Element root = document.getDocumentElement();
-
-            // Parse and initialize memory.
-            Element memoryElement = (Element) root.getElementsByTagName("memory").item(0);
-            Element implementationClassElement = (Element) memoryElement.getElementsByTagName("implementation-class").item(0);
-            Class<Memory> memoryImplementor = (Class<Memory>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-            setMemory(memoryImplementor.newInstance());
-            memory().initialize(getProperties(memoryElement));
-
-            // Parse and initialize mind.
-            Element mindElement = (Element) root.getElementsByTagName("mind").item(0);
-            implementationClassElement = (Element) mindElement.getElementsByTagName("implementation-class").item(0);
-            Class<Mind> mindImplementor = (Class<Mind>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-            setMind(mindImplementor.newInstance());
-            mind().initialize(getProperties(mindElement));
-
-            NodeList thoughtElements = ((Element) mindElement.getElementsByTagName("thoughts").item(0)).getElementsByTagName("thought");
-            for (int index = 0; index < thoughtElements.getLength(); index++) {
-                Element thoughtElement = (Element) thoughtElements.item(index);
-                implementationClassElement = (Element) thoughtElement.getElementsByTagName("implementation-class").item(0);
-                Class<Thought> thoughtImplementor = (Class<Thought>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-                Thought thought = thoughtImplementor.newInstance();
-                mind().addThought(thought);
-                thought.initialize(getProperties(thoughtElement));
-            }
-
-            // Parse and initialize mood.
-            Element moodElement = (Element) root.getElementsByTagName("mood").item(0);
-            if (moodElement != null) {
-                implementationClassElement = (Element) moodElement.getElementsByTagName("implementation-class").item(0);
-                Class<Mood> moodImplementor = (Class<Mood>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-                setMood(moodImplementor.newInstance());
-                mood().initialize(getProperties(moodElement));
-                NodeList emotionElements = ((Element) moodElement.getElementsByTagName("emotions").item(0)).getElementsByTagName("emotion");
-                for (int index = 0; index < emotionElements.getLength(); index++) {
-                    Element emotionElement = (Element) emotionElements.item(index);
-                    implementationClassElement = (Element) emotionElement.getElementsByTagName("implementation-class").item(0);
-                    Class<Emotion> emotionImplementor = (Class<Emotion>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-                    Emotion emotion = emotionImplementor.newInstance();
-                    mood().addEmotion(emotion);
-                    emotion.initialize(getProperties(emotionElement));
-                }
-            }
-
-            // Parse and initialize avatar.
-            Element avatarElement = (Element) root.getElementsByTagName("avatar").item(0);
-            implementationClassElement = (Element) avatarElement.getElementsByTagName("implementation-class").item(0);
-            Class<Avatar> avatarImplementor = (Class<Avatar>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-            setAvatar(avatarImplementor.newInstance());
-            avatar().initialize(getProperties(avatarElement));
-
-            // Parse and initialize awareness.
-            Element awarenessElement = (Element) root.getElementsByTagName("awareness").item(0);
-            implementationClassElement = (Element) awarenessElement.getElementsByTagName("implementation-class").item(0);
-            Class<Awareness> awarenessImplementor = (Class<Awareness>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-            setAwareness(awarenessImplementor.newInstance());
-            NodeList senseElements = ((Element) awarenessElement.getElementsByTagName("senses").item(0)).getElementsByTagName("sense");
-            for (int index = 0; index < senseElements.getLength(); index++) {
-                Element senseElement = (Element) senseElements.item(index);
-                implementationClassElement = (Element) senseElement.getElementsByTagName("implementation-class").item(0);
-                Class<Sense> senseImplementor = (Class<Sense>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-                Sense sense = senseImplementor.newInstance();
-                awareness().addSense(sense);
-                sense.initialize(getProperties(senseElement));
-            }
-            NodeList toolElements = ((Element) awarenessElement.getElementsByTagName("tools").item(0)).getElementsByTagName("tool");
-            for (int index = 0; index < toolElements.getLength(); index++) {
-                Element toolElement = (Element) toolElements.item(index);
-                implementationClassElement = (Element) toolElement.getElementsByTagName("implementation-class").item(0);
-                Class<Tool> toolImplementor = (Class<Tool>) Class.forName(implementationClassElement.getFirstChild().getNodeValue());
-                Tool tool = toolImplementor.newInstance();
-                awareness().addTool(tool);
-                tool.initialize(getProperties(toolElement));
-            }
-        } catch (Exception exception) {
-            throw new InitializationException(exception);
-        }
-    }
-
-    /**
-     * Shutdown the system gracefully, persist memory and terminate thoughts.
-     */
-    public synchronized void shutdown() {
-        if (this.state == ActiveState.SHUTDOWN) {
-            log(this, "Already shutdown", Level.INFO);
-            return;
-        }
-        this.state = ActiveState.SHUTDOWN;
-        log(this, "Shutting down", Level.INFO);
-        try {
-            awareness().shutdown();
-            mind().shutdown();
-            mood().shutdown();
-            avatar().shutdown();
-            memory().shutdown();
-        } catch (Exception exception) {
-            log(this, exception);
-        }
-        getLogListeners().clear();
-    }
-
-    /**
-     * Shutdown the pooled instance.
-     */
-    public static void forceShutdown(String name) {
-        Bot instance = instances.remove(name);
-        if (instance != null) {
-            instancesQueue.remove(name);
-            instance.log(instance, "Forced shutdown", Level.WARNING);
-            instance.shutdown();
-        }
-        Utils.sleep(1000);
-    }
-
-    public static void clearPool() {
-        while (instances.size() > 0) {
-            try {
-                String oldest = instancesQueue.remove();
-                Bot instance = instances.remove(oldest);
-                if (instance != null) {
-                    instance.shutdown();
-                }
-            } catch (Exception exception) {
-                new Bot().log(instancesQueue, exception);
-            }
-        }
-    }
-
-    /**
-     * Return the instance to the pool, or shutdown if too many instances pooled.
-     */
-    public synchronized void pool() {
-        if (this.state == ActiveState.SHUTDOWN) {
-            log(this, "Already shutdown", Level.INFO);
-            return;
-        }
-        if (this.state == ActiveState.POOLED) {
-            log(this, "Already pooled", Level.INFO);
-            return;
-        }
-        String name = memory().getMemoryName();
-        log(this, "Pooling instance", Level.INFO, name);
-        synchronized (memory()) {
-            memory().getShortTermMemory().clear();
-        }
-        if (Utils.checkLowMemory()) {
-            log(this, "Low memory - clearing server cache", Level.WARNING);
-            memory().freeMemory();
-        }
-        if ((Utils.checkLowMemory(0.2) && (memory().cacheSize() > MIN_CACHE)) || memory().cacheSize() > MAX_CACHE) {
-            log(this, "Cache too big - clearing server cache", Level.WARNING, memory().cacheSize(), MIN_CACHE, MAX_CACHE);
-            memory().freeMemory();
-        }
-        if (instances.containsKey(name)) {
-            shutdown();
-            return;
-        }
-        while (instances.size() >= POOL_SIZE) {
-            try {
-                String oldest = instancesQueue.remove();
-                Bot instance = instances.remove(oldest);
-                if (instance != null) {
-                    instance.shutdown();
-                }
-            } catch (Exception exception) {
-                log(instancesQueue, exception);
-            }
-        }
-        try {
-            awareness().pool();
-            mind().pool();
-            mood().pool();
-            avatar().pool();
-            memory().pool();
-        } catch (Exception exception) {
-            log(this, exception);
-        }
-        // Shutdown if put not successful.
-        setState(ActiveState.POOLED);
-        setDebugLevel(Level.INFO);
-        if (null != instances.putIfAbsent(name, this)) {
-            shutdown();
-            return;
-        } else {
-            instancesQueue.add(name);
-        }
-    }
-
-    /**
-     * Return the instance's name.
-     * This is the real name, but defaults to the database name.
-     */
-    public String getName() {
-        if (this.name == null) {
-            return memory().getMemoryName();
-        }
-        return this.name;
-    }
-
-    /**
-     * Set the instance's name.
-     * This is the real name, but defaults to the database name.
-     */
-    public void setName(String name) {
-        this.name = name;
-    }
-
-    public String toString() {
-        return "Bot(" + getName() + ")";
-    }
-
-    public String fullToString() {
-        StringWriter writer = new StringWriter();
-        writer.write("Bot(\n");
-
-        writer.write("\tmemory: ");
-        writer.write(memory().toString());
-        writer.write("\n");
-
-        writer.write("\tmind: ");
-        writer.write(mind().toString());
-        writer.write("\n");
-
-        for (Iterator<Thought> thoughtsIterator = mind().getThoughts().values().iterator(); thoughtsIterator.hasNext(); ) {
-            writer.write("\t\tthought: ");
-            writer.write(thoughtsIterator.next().toString());
-            writer.write("\n");
-        }
-
-        writer.write("\tmood: ");
-        writer.write(mood().toString());
-        writer.write("\n");
-
-        writer.write("\tavatar: ");
-        writer.write(avatar().toString());
-        writer.write("\n");
-
-        writer.write("\tawareness: ");
-        writer.write(awareness().toString());
-        writer.write("\n");
-
-        for (Iterator<Sense> sensesIterator = awareness().getSenses().values().iterator(); sensesIterator.hasNext(); ) {
-            writer.write("\t\tsense: ");
-            writer.write(sensesIterator.next().toString());
-            writer.write("\n");
-        }
-
-        for (Iterator<Tool> toolsIterator = awareness().getTools().values().iterator(); toolsIterator.hasNext(); ) {
-            writer.write("\t\ttool: ");
-            writer.write(toolsIterator.next().toString());
-            writer.write("\n");
-        }
-
-        writer.write(")");
-        return writer.toString();
-    }
-
-    public void addLogListener(LogListener listener) {
-        getLogListeners().add(listener);
-    }
-
-    public void removeLogListener(LogListener listener) {
-        getLogListeners().remove(listener);
-    }
-
-    public Set<LogListener> getLogListeners() {
-        return logListeners;
-    }
-
-    public void setLogListeners(Set<LogListener> logListeners) {
-        this.logListeners = logListeners;
-    }
-
-    public static ConcurrentMap<String, Bot> getInstances() {
-        return instances;
-    }
-
-}
-
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/BotLibreForBusinessCredentials.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/BotLibreForBusinessCredentials.java
deleted file mode 100644
index 1e1d448311846cd9c833cf825c23215b0e9c6c99..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/BotLibreForBusinessCredentials.java
+++ /dev/null
@@ -1,39 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk;
-
-/**
- * Credentials for use with hosted services on the Bot Libre for Business website,
- * a commercial bot, live chat, chatroom, and forum hosting service.
- * https://www.botlibre.biz
- */
-public class BotLibreForBusinessCredentials extends Credentials {
-	public static String DOMAIN = "www.botlibre.biz";
-	//public static String DOMAIN = "192.168.0.11:9080";
-	public static String APP = "";
-	//public static String APP = "/livechat";
-	public static String PATH = "/rest/api";
-
-	public BotLibreForBusinessCredentials(String applicationId) {
-		this.host = DOMAIN;
-		this.app = APP;
-		this.url = "https://" + DOMAIN + APP + PATH;
-		this.applicationId = applicationId;
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/Credentials.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/Credentials.java
index 4846f048f602de4b9a59d0382110e6640dd9237a..b9f826e378fab51e6b362995f5805d95902b0fa9 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/Credentials.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/Credentials.java
@@ -24,71 +24,90 @@ package org.botlibre.sdk;
  * You can obtain your application id from your user details page on the hosting website.
  */
 public class Credentials {
-	public String host = "";
-	public String app = "";
-	public String url = "";
-	/**
-	 * Your application's unique identifier.
-	 * You can obtain your application id from your user details page on the hosting website.
-	 */
-	public String applicationId = "";
+    public String host = "";
+    public String app = "";
+    public String url = "";
+    /**
+     * Your application's unique identifier.
+     * You can obtain your application id from your user details page on the hosting website.
+     */
+    public String applicationId = "";
 
-	public Credentials() {
-	}
+    /**
+     * Credentials
+     */
+    public Credentials() {
+    }
 
-	/**
-	 * Creates a new credentials for the service host url, and the application id.
-	 */
-	public Credentials(String url, String applicationId) {
-		this.url = url;
-		this.applicationId = applicationId;
-	}
+    /**
+     * getUrl
+     *
+     * @return url
+     */
+    public String getUrl() {
+        return url;
+    }
 
-	public String getUrl() {
-		return url;
-	}
-	
-	/**
-	 * Sets the hosted service server url, i.e. http://www.paphuslivechat.com
-	 */
-	public void setUrl(String url) {
-		this.url = url;
-	}
+    /**
+     * setUrl
+     *
+     * @param url
+     */
+    public void setUrl(String url) {
+        this.url = url;
+    }
 
-	public String getHost() {
-		return host;
-	}
+    /**
+     * getHost
+     *
+     * @return host
+     */
+    public String getHost() {
+        return host;
+    }
 
-	/**
-	 * Sets the server host name, i.e. www.paphuslivechat.com
-	 */
-	public void setHost(String host) {
-		this.host = host;
-	}
+    /**
+     * setHost
+     *
+     * @param host
+     */
+    public void setHost(String host) {
+        this.host = host;
+    }
 
-	public String getApp() {
-		return app;
-	}
+    /**
+     * getApp
+     *
+     * @return app
+     */
+    public String getApp() {
+        return app;
+    }
 
-	/**
-	 * Sets an app url postfix, this is normally not required, i.e. "".
-	 */
-	public void setApp(String app) {
-		this.app = app;
-	}
+    /**
+     * setApp
+     *
+     * @param app
+     */
+    public void setApp(String app) {
+        this.app = app;
+    }
 
-	/**
-	 * Returns your application's unique identifier.
-	 */
-	public String getApplicationId() {
-		return applicationId;
-	}
+    /**
+     * getApplicationId
+     *
+     * @return applicationId
+     */
+    public String getApplicationId() {
+        return applicationId;
+    }
 
-	/**
-	 * Sets your application's unique identifier.
-	 * You can obtain your application id from your user details page on the hosting website.
-	 */
-	public void setApplicationId(String applicationId) {
-		this.applicationId = applicationId;
-	}
+    /**
+     * setApplicationId
+     *
+     * @param applicationId
+     */
+    public void setApplicationId(String applicationId) {
+        this.applicationId = applicationId;
+    }
 }
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/FORUMSlibreCredentials.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/FORUMSlibreCredentials.java
deleted file mode 100644
index 59a8d17a0721977c6761cfceca527b62df494259..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/FORUMSlibreCredentials.java
+++ /dev/null
@@ -1,38 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk;
-
-/**
- * Credentials for use with hosted services on the FORUMS libre website, a free embeddable forum hosting service.
- * http://www.forumslibre.com
- */
-public class FORUMSlibreCredentials extends Credentials {
-	public static String DOMAIN = "www.forumslibre.com";
-	//public static String DOMAIN = "192.168.0.15:9080";
-	public static String APP = "";
-	//public static String APP = "/forumslibre";
-	public static String PATH = "/rest/api";
-
-	public FORUMSlibreCredentials(String applicationId) {
-		this.host = DOMAIN;
-		this.app = APP;
-		this.url = "http://" + DOMAIN + APP + PATH;
-		this.applicationId = applicationId;
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
deleted file mode 100644
index 97b136983accbc0132b1729ced2df22fef4f3f2e..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
+++ /dev/null
@@ -1,293 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk;
-
-import org.botlibre.sdk.config.ChannelConfig;
-import org.botlibre.sdk.config.UserConfig;
-
-import de.tavendo.autobahn.WebSocketConnection;
-import de.tavendo.autobahn.WebSocketConnectionHandler;
-
-/**
- * Connection class for a Live Chat, or chatroom connection.
- * A live chat connection is different than an SDKConnection as it is asynchronous,
- * and uses web sockets for communication.
- */
-public class LiveChatConnection {
-	protected boolean debug = false;
-	protected ChannelConfig channel;
-	protected UserConfig user;
-	protected Credentials credentials;
-    protected WebSocketConnection socket;
-    protected LiveChatListener listener;
-    protected boolean keepAlive = false;
-    protected Thread keepAliveThread;
-	
-    /**
-     * Create a new connection with the application credentials and the listener.
-     * The listener will be notified asynchronously of messages and events.
-     */
-	public LiveChatConnection(Credentials credentials, LiveChatListener listener) {
-		this.credentials = credentials;
-		this.listener = listener;
-	}
-	
-	/**
-	 * Connection to the live chat server channel.
-	 * Validate the user credentials.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void connect(ChannelConfig channel, UserConfig user) {
-		this.channel = channel;
-		this.user = user;
-		try {
-			this.socket = new WebSocketConnection();
-			this.socket.connect("ws://" + this.credentials.host + this.credentials.app
-						+ "/live/chat", new WebSocketConnectionHandler() {
-				@Override
-				public void onOpen() {
-					if (LiveChatConnection.this.user == null) {
-						LiveChatConnection.this.socket.sendTextMessage("connect " + LiveChatConnection.this.channel.id + " " + LiveChatConnection.this.credentials.applicationId);
-					} else {
-						LiveChatConnection.this.socket.sendTextMessage(
-								"connect " + LiveChatConnection.this.channel.id + " " + LiveChatConnection.this.user.user
-								+ " " + LiveChatConnection.this.user.token + " " + LiveChatConnection.this.credentials.applicationId);						
-					}
-				}
-
-				@Override
-				public void onTextMessage(String text) {
-			    	String user = "";
-			    	String message = text;
-			    	int index = text.indexOf(':');
-			    	if (index != -1) {
-			    		user = text.substring(0, index);
-			    		message = text.substring(index + 2, text.length());
-			    	}
-					if (user.equals("Online-xml")) {
-						return;
-					}
-					if (user.equals("Online")) {
-						LiveChatConnection.this.listener.updateUsers(message);
-						return;
-					}
-					
-					if (LiveChatConnection.this.keepAlive && user.equals("Info") && text.contains("pong")) {
-						return;
-					}
-					if (user.equals("Info")) {
-						LiveChatConnection.this.listener.info(text);
-						return;
-					}
-					if (user.equals("Error")) {
-						LiveChatConnection.this.listener.error(text);
-						return;
-					}
-					LiveChatConnection.this.listener.message(text);
-				}
-
-				@Override
-				public void onClose(int code, String reason) {
-					LiveChatConnection.this.listener.message("Info: Closed");
-					LiveChatConnection.this.listener.closed();
-				}
-			});
-		} catch (Exception exception) {
-			throw new SDKException(exception);
-		}
-	}
-
-	/**
-	 * Sent a text message to the channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 * Note, the listener will receive its own messages.
-	 */
-	public void sendMessage(String message) {
-		checkSocket();
-		if (message == null) {
-			return;
-		}
-		this.socket.sendTextMessage(message);
-	}
-
-	/**
-	 * Accept a private request.
-	 * This is also used by an operator to accept the top of the waiting queue.
-	 * This can also be used by a user to chat with the channel bot.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void accept() {
-		checkSocket();
-		this.socket.sendTextMessage("accept");
-	}
-
-	/**
-	 * Test the connection.
-	 * A pong message will be returned, this message will not be broadcast to the channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void ping() {
-		checkSocket();
-		this.socket.sendTextMessage("ping");
-	}
-
-	/**
-	 * Exit from the current private channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void exit() {
-		checkSocket();
-		this.socket.sendTextMessage("exit");
-	}
-
-	/**
-	 * Request a private chat session with a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void pvt(String user) {
-		checkSocket();
-		this.socket.sendTextMessage("pvt: " + user);
-	}
-
-	/**
-	 * Boot a user from the channel.
-	 * You must be a channel administrator to boot a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void boot(String user) {
-		checkSocket();
-		this.socket.sendTextMessage("boot: " + user);
-	}
-
-	/**
-	 * Send a private message to a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void whisper(String user, String message) {
-		checkSocket();
-		this.socket.sendTextMessage("whisper:" + user + ": " + message);
-	}
-
-	/**
-	 * Disconnect from the channel.
-	 */
-	public void disconnect() {
-    	this.keepAlive = false;
-    	if (this.keepAliveThread != null) {
-    		this.keepAliveThread.interrupt();
-    	}
-    	if (this.socket != null) {
-    		this.socket.disconnect();
-    	}
-	}
- 
-    protected void runKeepAlive() {
-    	this.keepAliveThread = new Thread() {
-    		public void run() {
-    			while (keepAlive) {
-	    			sendMessage("ping");
-	    			try {
-	    				Thread.sleep(600000);
-	    			} catch (InterruptedException exception) {
-	    				return;
-	    			}
-    			}
-    		}
-    	};
-    	this.keepAliveThread.start();
-    }
-    
-    public boolean isDebug() {
-		return debug;
-	}
-
-	/**
-	 * Enable debugging messages (logged to System.out).
-	 */
-	public void setDebug(boolean debug) {
-		this.debug = debug;
-	}
-
-	/**
-	 * Return the current channel.
-	 */
-	public ChannelConfig getChannel() {
-		return channel;
-	}
-
-	protected void setChannel(ChannelConfig channel) {
-		this.channel = channel;
-	}
-
-	/**
-	 * Return the current user.
-	 */
-	public UserConfig getUser() {
-		return user;
-	}
-
-	protected void setUser(UserConfig user) {
-		this.user = user;
-	}
-
-	/**
-	 * Return the current application credentials.
-	 */
-	public Credentials getCredentials() {
-		return credentials;
-	}
-
-	protected void setCredentials(Credentials credentials) {
-		this.credentials = credentials;
-	}
-
-	public LiveChatListener getListener() {
-		return listener;
-	}
-
-	public void setListener(LiveChatListener listener) {
-		this.listener = listener;
-	}
-
-	/**
-	 * Return if the connection will be kept alive, and not allowed to timeout due to inAbility.
-	 */
-	public boolean isKeepAlive() {
-		return keepAlive;
-	}
-
-	/**
-	 * Set if the connection should be kept alive, and not allowed to timeout due to inAbility.
-	 */
-	public void setKeepAlive(boolean keepAlive) {
-		this.keepAlive = keepAlive;
-    	if (this.keepAlive) {
-    		runKeepAlive();
-    	} else if (this.keepAliveThread != null) {
-    		this.keepAliveThread.interrupt();
-    		this.keepAliveThread = null;
-    	}
-    }
-	
-	protected void checkSocket() {
-		if (this.socket == null) {
-			throw new SDKException("Not connected");
-		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/LiveChatListener.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/LiveChatListener.java
deleted file mode 100644
index 725be7495ee51c357a0837dba02d312337dbabe5..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/LiveChatListener.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk;
-
-/**
- * Listener interface for a LiveChatConnection.
- * This gives asynchronous notification when a channel receives a message, or notice.
- */
-public interface LiveChatListener {
-	/**
-	 * A user message was received from the channel.
-	 */
-	void message(String message);
-	
-	/**
-	 * An informational message was received from the channel.
-	 * Such as a new user joined, private request, etc.
-	 */	
-	void info(String message);
-
-	/**
-	 * An error message was received from the channel.
-	 * This could be an access error, or message failure.
-	 */	
-	void error(String message);
-	
-	/**
-	 * Notification that the connection was closed.
-	 */
-	void closed();
-	
-	/**
-	 * The channels users changed (user joined, left, etc.)
-	 * This contains a comma separated values (CSV) list of the current channel users.
-	 * It can be passed to the SDKConnection.getUsers() API to obtain the UserConfig info for the users.
-	 */
-	void updateUsers(String usersCSV);
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/MainAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/MainAbility.java
index c2a34ee40a39003dedf6443d30164e49e45994ae..05b3b368551c29af8a61b281a923ad9a1db138fd 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/MainAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/MainAbility.java
@@ -1,44 +1,5 @@
 package org.botlibre.sdk;
 
-import org.botlibre.sdk.activityy.BotSearchAbility;
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.activityy.ChatAbility2;
-import org.botlibre.sdk.activityy.CreateUserAbility;
-import org.botlibre.sdk.activityy.HelpAbility;
-import org.botlibre.sdk.activityy.LibreAbility;
-import org.botlibre.sdk.activityy.ListTemplateView;
-import org.botlibre.sdk.activityy.LoginAbility;
-import org.botlibre.sdk.activityy.actions.HttpConnectAction;
-import org.botlibre.sdk.activityy.actions.HttpFetchAction;
-import org.botlibre.sdk.activityy.actions.HttpFetchOrCreateAction;
-import org.botlibre.sdk.activityy.actions.HttpGetImageAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.actions.HttpGetTemplatesAction;
-import org.botlibre.sdk.activityy.dialog.SpinnerDialogBuilder;
-import org.botlibre.sdk.activityy.listener.LanguageListener;
-import org.botlibre.sdk.activityy.listener.SelectListener;
-import org.botlibre.sdk.activityy.war.StartWarAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.AvatarMedia;
-import org.botlibre.sdk.config.BotModeConfig;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ChannelConfig;
-import org.botlibre.sdk.config.DomainConfig;
-import org.botlibre.sdk.config.ForumConfig;
-import org.botlibre.sdk.config.ForumPostConfig;
-import org.botlibre.sdk.config.GraphicConfig;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.IssueConfig;
-import org.botlibre.sdk.config.LearningConfig;
-import org.botlibre.sdk.config.OfflineTemplateConfig;
-import org.botlibre.sdk.config.ResponseConfig;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import org.botlibre.sdk.config.UserConfig;
-import org.botlibre.sdk.config.VoiceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.micro.MicroConnection;
-import org.botlibre.sdk.util.PreferencesUtils;
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
 import ohos.aafwk.content.Operation;
@@ -66,8 +27,41 @@ import ohos.multimodalinput.event.TouchEvent;
 import ohos.security.SystemPermission;
 import ohos.utils.net.Uri;
 import org.botlibre.knowledge.micro.MicroMemory;
+import org.botlibre.sdk.ability.BotSearchAbility;
+import org.botlibre.sdk.ability.ChatAbility;
+import org.botlibre.sdk.ability.ChatAbility2;
+import org.botlibre.sdk.ability.CreateUserAbility;
+import org.botlibre.sdk.ability.HelpAbility;
+import org.botlibre.sdk.ability.LibreAbility;
+import org.botlibre.sdk.ability.ListTemplateView;
+import org.botlibre.sdk.ability.LoginAbility;
+import org.botlibre.sdk.ability.actions.HttpGetTemplatesAction;
+import org.botlibre.sdk.ability.dialog.SpinnerDialogBuilder;
+import org.botlibre.sdk.ability.listener.LanguageListener;
+import org.botlibre.sdk.ability.listener.SelectListener;
+import org.botlibre.sdk.ability.war.StartWarAbility;
+import org.botlibre.sdk.config.AvatarConfig;
+import org.botlibre.sdk.config.AvatarMedia;
+import org.botlibre.sdk.config.BotModeConfig;
+import org.botlibre.sdk.config.BrowseConfig;
+import org.botlibre.sdk.config.ChannelConfig;
+import org.botlibre.sdk.config.DomainConfig;
+import org.botlibre.sdk.config.ForumConfig;
+import org.botlibre.sdk.config.ForumPostConfig;
+import org.botlibre.sdk.config.GraphicConfig;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.IssueConfig;
+import org.botlibre.sdk.config.LearningConfig;
+import org.botlibre.sdk.config.OfflineTemplateConfig;
+import org.botlibre.sdk.config.ResponseConfig;
+import org.botlibre.sdk.config.ScriptConfig;
+import org.botlibre.sdk.config.ScriptSourceConfig;
+import org.botlibre.sdk.config.UserConfig;
+import org.botlibre.sdk.config.VoiceConfig;
+import org.botlibre.sdk.config.WebMediumConfig;
+import org.botlibre.sdk.micro.MicroConnection;
+import org.botlibre.sdk.util.PreferencesUtils;
 
-import javax.swing.text.View;
 import java.awt.*;
 import java.io.File;
 import java.util.ArrayList;
@@ -128,7 +122,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     /**
      * If you are building a single instance app, then you can set the instance id or name here,
-     * and use this activity to launch it.
+     * and use this  to launch it.
      */
     public static String launchInstanceId = ""; // i.e. "171"
     public static String launchInstanceName = "Bot Libre!"; // i.e. "Help Bot"
@@ -362,80 +356,27 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         super.onActive();
     }
 
-    //    //    @TargetApi(Build.VERSION_CODES.KITKAT)
-////    @SuppressLint("NewApi")
-//    public static String getFilePathFromURI(Context context, Uri uri) {
-//        // DocumentProvider
-//        if (DocumentsContract.isDocumentUri(context, uri)) {
-//
-//            // ExternalStorageProvider
-//            if (ohos(uri)) {
-//                final String docId = DocumentsContract.getDocumentId(uri);
-//                final String[] split = docId.split(":");
-//                final String type = split[0];
-//
-//                if ("primary".equalsIgnoreCase(type)) {
-//                    return Environment.getExternalStorageDirectory() + "/" + split[1];
-//                }
-//                // TODO handle non-primary volumes
-//            }
-//            // DownloadsProvider
-//            else if (isDownloadsDocument(uri)) {
-//                final String id = DocumentsContract.getDocumentId(uri);
-//                final Uri contentUri = ContentUris.withAppendedId(Uri.parse("content://downloads/public_downloads"),
-//                        Long.valueOf(id));
-//                return getDataColumn(context, contentUri, null, null);
-//            }
-//            // MediaProvider
-//            else if (isMediaDocument(uri)) {
-//                final String docId = DocumentsContract.getDocumentId(uri);
-//                final String[] split = docId.split(":");
-//                final String type = split[0];
-//                Uri contentUri = null;
-//                if ("image".equals(type)) {
-//                    contentUri = MediaStore.Images.Media.EXTERNAL_CONTENT_URI;
-//                } else if ("video".equals(type)) {
-//                    contentUri = MediaStore.Video.Media.EXTERNAL_CONTENT_URI;
-//
-//                } else if ("audio".equals(type)) {
-//                    contentUri = MediaStore.Audio.Media.EXTERNAL_CONTENT_URI;
-//                }
-//                final String selection = "_id=?";
-//                final String[] selectionArgs = new String[]{split[1]};
-//                return getDataColumn(context, contentUri, selection, selectionArgs);
-//            }
-//        }
-//        // MediaStore (and general)
-//        else if ("content".equalsIgnoreCase(uri.getScheme())) {
-//            // Return the remote address
-//            if (isGooglePhotosUri(uri))
-//                return uri.getLastPathSegment();
-//            return getDataColumn(context, uri, null, null);
-//        }
-//        // File
-//        else if ("file".equalsIgnoreCase(uri.getScheme())) {
-//            return uri.getPath();
-//        }
-//        return null;
-//    }
-
+    /**
+     * getDataColumn
+     *
+     * @param context
+     * @param uri
+     * @param selection
+     * @param selectionArgs
+     * @return
+     */
     public static String getDataColumn(Context context, Uri uri, String selection, String[] selectionArgs) {
-//        Cursor cursor = null;
-//        final String column = "_data";
-//        final String[] projection = {column};
-//        try {
-//            cursor = context.getContentResolver().query(uri, projection, selection, selectionArgs, null);
-//            if (cursor != null && cursor.moveToFirst()) {
-//                final int index = cursor.getColumnIndexOrThrow(column);
-//                return cursor.getString(index);
-//            }
-//        } finally {
-//            if (cursor != null)
-//                cursor.close();
-//        }
+
         return null;
     }
 
+    /**
+     * getFileSize
+     *
+     * @param q
+     * @param a
+     * @return
+     */
     public static Boolean getFileSize(String q, Context a) {
         if (q == null || q.equals("")) {
             return true;
@@ -457,70 +398,42 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is DownloadsProvider.
-     */
-    public static boolean isDownloadsDocument(Uri uri) {
-        return "com.ohos.providers.downloads.documents".equals(uri.getDecodedAuthority());
-    }
-
-    /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is MediaProvider.
-     */
-    public static boolean isMediaDocument(Uri uri) {
-        return "com.ohos.providers.media.documents".equals(uri.getDecodedAuthority());
-    }
-
-    /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is Google Photos.
+     * isTablet
+     *
+     * @param context
+     * @return ds
      */
-
-    public static boolean isGooglePhotosUri(Uri uri) {
-        return "com.google.ohos.apps.photos.content".equals(uri.getDecodedAuthority());
-    }
-
-    public static String getFileNameFromPath(String path) {
-        int index = path.lastIndexOf("/");
-        return path.substring(index + 1, path.length());
-    }
-
-//    public static String getFileTypeFromPath(String path) {
-//        int index = path.lastIndexOf(".");
-//        String ext = path.substring(index + 1, path.length());
-//        if (ext.equalsIgnoreCase("webm")) {
-//            return "video/webm";
-//        }
-//        return MimeTypeMap.getSingleton().getMimeTypeFromExtension(ext);
-//    }
-
     public static boolean isTablet(Context context) {
 //        return (context.getResourceManager().getConfiguration().isLayoutRTL
 //                & Configuration.AUTO_MODE) >= Configuration.AUTO_MODE;
         return true;
     }
 
-    @SuppressWarnings("rawtypes")
+    /**
+     * getActivity
+     *
+     * @param config
+     * @return
+     */
     public static Class getActivity(WebMediumConfig config) {
         if (config instanceof ChannelConfig) {
-//            return ChannelAbility.class; //====================
         } else if (config instanceof ForumConfig) {
-//            return ForumAbility.class; //====================
         } else if (config instanceof InstanceConfig) {
-//            return BotAbility.class; //====================
         } else if (config instanceof DomainConfig) {
-//            return DomainAbility.class; //====================
         } else if (config instanceof AvatarConfig) {
-//            return AvatarAbility.class; //====================
         } else if (config instanceof ScriptConfig) {
-//            return ScriptAbility.class; //====================
         } else if (config instanceof GraphicConfig) {
-//            return GraphicAbility.class; //====================
         }
         return null;
     }
 
+    /**
+     * error
+     *
+     * @param message
+     * @param exception
+     * @param activity
+     */
     public static void error(String message, Exception exception, Ability activity) {
         try {
             if (DEBUG) {
@@ -541,6 +454,14 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
+    /**
+     * errorInfo
+     *
+     * @param type
+     * @param message
+     * @param exception
+     * @param activity
+     */
     public static void errorInfo(int type, String message, Exception exception, Ability activity) {
         try {
             if (DEBUG) {
@@ -561,6 +482,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
+    /**
+     * showMessage
+     *
+     * @param title
+     * @param message
+     * @param activity
+     */
     public static void showMessage(String title, String message, Ability activity) {
         CommonDialog mCommonDialog = new CommonDialog(activity);
         Optional<Display>
@@ -589,6 +517,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
+    /**
+     * showLogin
+     *
+     * @param title
+     * @param message
+     * @param activity
+     */
     public void showLogin(String title, String message, Ability activity) {
         CommonDialog mCommonDialog = new CommonDialog(activity);
         Optional<Display>
@@ -620,6 +555,14 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     public static Text execcontentinfo;
 
+    /**
+     * showMessageInfo
+     *
+     * @param type
+     * @param title
+     * @param message
+     * @param activity
+     */
     public static void showMessageInfo(int type, String title, String message, Ability activity) {
         CommonDialog mCommonDialog = new CommonDialog(activity);
         Optional<Display>
@@ -655,10 +598,24 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
+    /**
+     * showMessage
+     *
+     * @param message
+     * @param activity
+     */
     public static void showMessage(String message, Ability activity) {
         showMessage(null, message, activity);
     }
 
+    /**
+     * prompt
+     *
+     * @param message
+     * @param activity
+     * @param text
+     * @param listener
+     */
     public static void prompt(String message, Ability activity, TextField text, IDialog.ClickedListener listener) {
         CommonDialog dialog = new CommonDialog(activity);
         dialog.setContentText(message);
@@ -673,32 +630,14 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         dialog.show();
     }
 
-    public void contentRatingList() {
-        CommonDialog builder = new CommonDialog(this);
-        builder.setTitleText("Content Rating");
-
-        builder.setContentText("Select Content Rating: ");
-        builder.setButton(1, "Cancel", new IDialog.ClickedListener() {
-            @Override
-            public void onClick(IDialog iDialog, int id) {
-                // save data
-//                Preferences editor = MainAbility.current.getp.getPreferences(Context.MODE_PRIVATE)
-//                        .edit();
-//                editor.putString("contentRating", (String) spin.getSelectedItem());
-//                contentRating = (String) spin.getSelectedItem();
-//                editor.flush();
-            }
-        });
-
-        builder.setButton(1, "Cancel", new IDialog.ClickedListener() {
-            @Override
-            public void onClick(IDialog iDialog, int i) {
-
-            }
-        });
-        builder.show();
-    }
-
+    /**
+     * confirm
+     *
+     * @param message
+     * @param activity
+     * @param cancelable
+     * @param listener
+     */
     public static void confirm(String message, Ability activity, Boolean cancelable, IDialog.ClickedListener listener) {
         CommonDialog dialog = new CommonDialog(activity);
         dialog.setTitleText("Bot Libre!");
@@ -711,6 +650,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         dialog.show();
     }
 
+    /**
+     * getAllTemplates
+     *
+     * @param activity
+     * @return ds
+     */
     public static List<InstanceConfig> getAllTemplates(Ability activity) {
         if (templates == null) {
             try {
@@ -725,7 +670,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         return templates;
     }
 
-    public static final int REQ_PERMISSION_CODE = 1003;
     private final List<String> mPermissions =
             new LinkedList<>(
                     Arrays.asList(
@@ -734,7 +678,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     @Override
     public void onStart(Intent intent) {
         super.onStart(intent);
-//        super.setMainRoute(MainAbilitySlice.class.getName());
         searching = false;
         browsing = false;
         searchingPosts = false;
@@ -764,16 +707,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
         loadMemoryByBot();
 
-//        WebMediumConfig config1 = new InstanceConfig();
-//        OfflineTemplateConfig templates = new OfflineTemplateConfig();
-//        config1.id = "1";
-//        config1.name = "Empty";
-//        MicroConnection connection = new MicroConnection(new BOTlibreCredentials("applicationId"));
-//        connection.fetch(config1);
-
-
-        // Checking and making sure that the mic is turned off to start
-        // configuring the microphone.
         micConfig = cookies.getBoolean("miconfig", micConfig);
 
         if (user == null) {
@@ -796,8 +729,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
                 UserConfig config = new UserConfig();
                 config.user = user;
                 config.token = token;
-                HttpConnectAction action = new HttpConnectAction(this, config, false);
-//                action.execute();
             }
 
             String voice = cookies.getString("voice", null);
@@ -847,6 +778,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
+    /**
+     * initChat
+     */
     public void initChat() {
         chatButton = (Button) findComponentById(ResourceTable.Id_chatButton); // chat
         chatButton.setClickedListener(new Component.ClickedListener() {
@@ -857,6 +791,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
+    /**
+     * initMain
+     */
     public void initMain() {
         spin = (Button) findComponentById(ResourceTable.Id_selectButton); // 底部类型选择
         spin.setClickedListener(new Component.ClickedListener() {
@@ -918,6 +855,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
+    /**
+     * initBrowse
+     */
     public void initBrowse() {
         chatButton = (Button) findComponentById(ResourceTable.Id_chatButton);
         chatButton.setClickedListener(new Component.ClickedListener() {
@@ -954,17 +894,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    //动态权限
-    private void reqPermissions() {
-        mPermissions.removeIf(perM -> verifySelfPermission(perM) == PERMISSION_GRANTED || !canRequestPermission(perM));
-        if (!mPermissions.isEmpty()) {
-            requestPermissionsFromUser(
-                    mPermissions.toArray(new String[0]), MainAbility.REQ_PERMISSION_CODE);
-        } else {
-            // 功能调用
-        }
-    }
-
     /**
      * 权限回调
      *
@@ -988,9 +917,11 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
+    /**
+     * resetView
+     */
     public void loadMemoryByBot() {
         MicroMemory.storageDir = getFilesDir();
-        //MicroMemory.storageDir = getExternalFilesDir(null);
         List<OfflineTemplateConfig> items = new ArrayList<OfflineTemplateConfig>();
         items = ListTemplateView.retriveTemplates();
         OfflineTemplateConfig oneItem;
@@ -1002,7 +933,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         launchInstanceId = oneItem.getId();
     }
 
-    @SuppressWarnings({"unchecked", "rawtypes"})
+    /**
+     * resetView
+     */
     public void resetView() {
         menuButton = (Button) findComponentById(ResourceTable.Id_menuButton); // 菜单选择
         menuButton.setClickedListener(new Component.ClickedListener() {
@@ -1013,38 +946,18 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
 
 
-
         if (domain != null) {
-//            setTitle(Utils.stripTags(domain.name));
-            HttpGetImageAction.fetchImage(this, domain.avatar, null); //-----------------
-//            HttpGetImageAction.fetchImage(this, domain.avatar, (Image) findComponentById(ResourceTable.Id_splash));
         }
 
-//        if (MainAbility.user == null) {
-//            findComponentById(ResourceTable.Id_viewUserButton).setVisibility(HIDE);
-//            //findViewById(R.id.logoutButton).setVisibility(View.GONE);
-//            //findViewById(R.id.loginButton).setVisibility(View.VISIBLE);
-//        } else {
-//            //findViewById(R.id.logoutButton).setVisibility(View.VISIBLE);
-//            //findViewById(R.id.loginButton).setVisibility(View.GONE);
-//            findComponentById(ResourceTable.Id_viewUserButton).setVisibility(VISIBLE);
-//            //HttpGetImageAction.fetchImage(this, MainActivity.user.avatar, findViewById(R.id.viewUserButton));
-//        }
+
         resetMenu(this.menu);
         resetLast();
     }
 
+    /**
+     * resetLast
+     */
     public void resetLast() {
-//        String type = MainAbility.defaultType;
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);  // 需要放入 adapter中做判断
-//        if (spin != null) {
-//            type = (String) spin.getSelectedItem();
-//            if (type.equals("Chat Bot Wars")) {
-//                spin.setSelection(0);
-//                war(null);
-//                return;
-//            }
-//        }
         if (type.equals("Chat Bot Wars")) {
             war();
             return;
@@ -1082,12 +995,10 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     }
 
+    /**
+     * openLast
+     */
     public void openLast() {
-
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);  // 适配器中做了选择赋值
-//        if (spin != null) {
-//            type = (String) spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
@@ -1131,11 +1042,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             config = new InstanceConfig();
         }
         config.name = last;
-
-        HttpFetchAction action = new HttpFetchAction(this, config);
-//        action.execute();
     }
 
+    /**
+     * resetMenu
+     *
+     * @param menu
+     */
     public void resetMenu(Menu menu) {
         if (menu == null) {
             return;
@@ -1143,65 +1056,32 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         for (int index = 0; index < menu.getItemCount(); index++) {
             menu.getItem(index).setEnabled(true);
         }
-        if (MainAbility.user == null) {
-            //menu.findItem(R.id.menuMyBots).setEnabled(false);
-            //menu.findItem(R.id.menuSignOut).setEnabled(false);
-            //menu.findItem(R.id.menuViewUser).setEnabled(false);
-            //menu.findItem(R.id.menuEditUser).setEnabled(false);
-        } else {
-            //menu.findItem(R.id.menuSignIn).setEnabled(false);
-            //menu.findItem(R.id.menuSignUp).setEnabled(false);
-        }
 
-		/*if (MicroMemory.checkExists()) {
-			menu.findItem(R.id.menuDeleteExistingBot).setEnabled(true);
-		} else {
-			menu.findItem(R.id.menuDeleteExistingBot).setEnabled(false);
-		}*/
-
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String) spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
-        // MenuItem item = menu.findItem(R.id.menuMyBots);
-        // if (type.equals("Bots")) {
-        // item.setTitle("My Bots");
-        // } else if (type.equals("Forums")) {
-        // item.setTitle("My Forums");
-        // } else if (type.equals("Live Chat")) {
-        // item.setTitle("My Channels");
-        // } else if (type.equals("Domains")) {
-        // item.setTitle("My Domains");
-        // } else if (type.equals("Avatars")) {
-        // item.setTitle("My Avatars");
-        // } else if (type.equals("Scripts")){
-        // item.setTitle("My Scripts");
-        // }else if (type.equals("Graphics")){
-        // item.setTitle("My Graphics");
-        // }
+
     }
 
+    /**
+     * war
+     */
     public void war() {
         startOpenAbility(this, StartWarAbility.class.getName());
     }
 
+    /**
+     * login
+     */
     public void login() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-
         startOpenAbility(this, LoginAbility.class.getName());
     }
 
+    /**
+     * logout
+     */
     public void logout() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
+
         connection.disconnect();
         user = null;
         instance = null;
@@ -1237,13 +1117,15 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         editor.delete("deviceVoice");
         editor.flushSync();
 
-        HttpGetImageAction.clearFileCache(this);
 
         Intent intent = getIntent();
         terminateAbility();
         startAbility(intent);
     }
 
+    /**
+     * menu
+     */
     public void menu() {
         Optional<Display>
                 display = DisplayManager.getInstance().getDefaultDisplay(this);
@@ -1285,28 +1167,18 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
+    /**
+     * createUser
+     */
     public void createUser() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//
-//        Intent intent = new Intent(this, CreateUserActivity.class);
-//        startActivity(intent);
         startOpenAbility(this, CreateUserAbility.class.getName());
     }
 
-    public void editUser() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//
-//        Intent intent = new Intent(this, EditUserActivity.class);
-//        startActivity(intent);
-//        startOpenAbility(this, EditUserAbility.class.getName()); //================
-    }
-
+    /**
+     * setOnline
+     *
+     * @param result
+     */
     public static void setOnline(boolean result) {
         if (result) {
             connection = remoteConnection;
@@ -1317,27 +1189,23 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
 
+    /**
+     * help
+     */
     public void help() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//        super.help(view);
         startOpenAbility(this, HelpAbility.class.getName());
     }
 
+    /**
+     * viewUser
+     */
     public void viewUser() {
         viewUser = user;
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-
-//        Intent intent = new Intent(this, ViewUserActivity.class);
-//        startActivity(intent);
-//        startOpenAbility(this, ViewUserAbility.class.getName()); //================
     }
 
+    /**
+     * openWebsite
+     */
     public void openWebsite() {
         try {
             Intent intent2 = new Intent();
@@ -1351,94 +1219,38 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
+    /**
+     * createInstance
+     */
     public void createInstance() {
         if (user == null) {
             showLogin("", "You must sign in first", this);
             return;
         }
-//        Spinner spin = (Spinner) findViewById(getResources().getIdentifier("typeSpin", "id", getPackageName()));
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
         if (type.equals("Bots")) {
             MainAbility.template = "";
-//            Intent intent = new Intent(this, CreateBotActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateBotAbility.class.getName()); //================
-        } else if (type.equals("Forums")) {
-//            Intent intent = new Intent(this, CreateForumActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateForumAbility.class.getName()); //================
-        } else if (type.equals("Live Chat")) {
-//            Intent intent = new Intent(this, CreateChannelActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateChannelAbility.class.getName()); //================
-        } else if (type.equals("Domains")) {
-//            Intent intent = new Intent(this, CreateDomainActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateDomainAbility.class.getName()); //================
-        } else if (type.equals("Avatars")) {
-//            Intent intent = new Intent(this, CreateAvatarActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateAvatarAbility.class.getName()); //================
-        } else if (type.equals("Scripts")) {
-//            Intent intent = new Intent(this, CreateScriptActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateScriptAbility.class.getName()); //================
-        } else if (type.equals("Graphics")) {
-//            Intent intent = new Intent(this, CreateGraphicActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateGraphicAbility.class.getName()); //================
         }
     }
 
+    /**
+     * search
+     */
     public void search() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
         if (type.equals("Bots")) {
-//            Intent intent = new Intent(this, BotSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
-        } else if (type.equals("Forums")) {
-//            Intent intent = new Intent(this, ForumSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ForumSearchAbility.class.getName()); //================
-        } else if (type.equals("Live Chat")) {
-//            Intent intent = new Intent(this, ChannelSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ChannelSearchAbility.class.getName()); //================
-        } else if (type.equals("Domains")) {
-//            Intent intent = new Intent(this, DomainSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, DomainSearchAbility.class.getName()); //================
-        } else if (type.equals("Avatars")) {
-//            Intent intent = new Intent(this, AvatarSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, AvatarSearchAbility.class.getName()); //================
-        } else if (type.equals("Scripts")) {
-//            Intent intent = new Intent(this, ScriptSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ScriptSearchAbility.class.getName()); //================
-        } else if (type.equals("Graphics")) {
-//            Intent intent = new Intent(this, GraphicSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, GraphicSearchAbility.class.getName()); //================
         }
     }
 
+    /**
+     * browseMyBots
+     */
     public void browseMyBots() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
@@ -1460,15 +1272,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             config.type = "Graphic";
         }
         config.contentRating = "Mature";
-        HttpGetInstancesAction action = new HttpGetInstancesAction(this, config);
-//        action.execute();
     }
 
+    /**
+     * browse
+     */
     public void browse() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
@@ -1490,8 +1299,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             config.type = "Graphic";
         }
         config.contentRating = MainAbility.contentRating;
-        HttpGetInstancesAction action = new HttpGetInstancesAction(this, config);
-//        action.execute();
     }
 
     /**
@@ -1508,23 +1315,14 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
         config.id = launchInstanceId;
         config.name = launchInstanceName;
-
-        HttpFetchAction action = new HttpFetchAction(this, config, false);
-//        action.execute();
     }
 
     /**
-     * Start a chat session with the hard coded instance.
-     */
-
-    /*
-     * This method will have a list of 8 empty bot, basic, AI, julie, eddie,
-     * alice, personal assistance, juile assistance. before attaching the ID and
-     * Name of the bot make sure that its selecetd thro the list.
+     * launch
      */
     public void launch() {
         setOnline(false);
-         WebMediumConfig config = null;
+        WebMediumConfig config = null;
         // the launch type is bot.
         if (MainAbility.launchType == LaunchType.Bot) {
             if (null == instance || null == this.instance.name || this.instance.name.equals("")) {
@@ -1539,19 +1337,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
                     config.name = MainAbility.launchInstanceName;
                     MicroConnection microConnection = (MicroConnection) MainAbility.getConnection();
                     microConnection.fetch(config);
-                    if(MainAbility.launchInstanceName.contains("Assistance")){
+                    if (MainAbility.launchInstanceName.contains("Assistance")) {
                         startOpenAbility(MainAbility.this, ChatAbility2.class.getName());
-                    }else{
+                    } else {
                         startOpenAbility(MainAbility.this, ChatAbility.class.getName());
                     }
                 }
             } else {
-//                config = new InstanceConfig();
-//                readZipAvatars(this, this.nameOfAvatar);
-//                config.name = MainAbility.launchInstanceName;
-//                config.id = MainAbility.launchInstanceId;
-//                HttpFetchActionOffline action = new HttpFetchActionOffline(this, config, true);
-//                action.execute();
             }
         } else if (MainAbility.launchType == LaunchType.Forum) {
             config = new ForumConfig();
@@ -1560,8 +1352,14 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
+    /**
+     * saveAllData
+     *
+     * @param instanceId
+     * @param instanceName
+     * @param id
+     */
     public void saveAllData(String instanceId, String instanceName, int id) {
-//        Preferences cookies = MainAbility.current.getPreferences(Context.MODE_PRIVATE).edit();
         Preferences cookies = PreferencesUtils.getPreferences(this);
         cookies.putString("instanceID", instanceId);
         cookies.putString("instanceName", instanceName);
@@ -1569,55 +1367,11 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         cookies.flushSync();
     }
 
-    /**
-     * View the user's personal instance.
-     */
-    public void browseMyBot() {
-        if (user == null) {
-            CommonDialog dialog = new CommonDialog(this);
-            dialog.setContentText("You must sign in first");
-            dialog.setButton(1, "OK", new IDialog.ClickedListener() {
-                @Override
-                public void onClick(IDialog iDialog, int i) {
-                    login();
-                }
-            });
-            dialog.show();
-            return;
-        }
-        WebMediumConfig config = new InstanceConfig();
-        config.name = "Bot " + MainAbility.user.user;
-
-        HttpFetchOrCreateAction action = new HttpFetchOrCreateAction(this, config, false);
-//        action.execute();
-    }
+    public static String selectInfo = "";
 
     /**
-     * Start a chat session with the user's personal instance.
+     * changeLanguage
      */
-    public void launchMyBot(View view) {
-        if (user == null) {
-            CommonDialog dialog = new CommonDialog(this);
-            dialog.setContentText("You must sign in first");
-            dialog.setButton(1, "OK", new IDialog.ClickedListener() {
-                @Override
-                public void onClick(IDialog iDialog, int i) {
-                    login();
-                }
-            });
-            dialog.show();
-            return;
-        }
-        WebMediumConfig config = new InstanceConfig();
-        config.name = "Bot " + MainAbility.user.user;
-
-        HttpFetchOrCreateAction action = new HttpFetchOrCreateAction(this, config, true);
-//        action.execute();
-    }
-
-    public static String selectInfo = "";
-
-    @SuppressWarnings({"rawtypes", "unchecked"})
     public void changeLanguage() {
         Optional<Display>
                 display = DisplayManager.getInstance().getDefaultDisplay(this);
@@ -1654,20 +1408,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
+    /**
+     * readZipAvatars
+     *
+     * @param activity
+     * @param fileName
+     */
     public static void readZipAvatars(Ability activity, String fileName) {
-        // this is only for letting Julie Assistance Avatar works, since there
-        // is only one file called
-        // "Julie" I will have to take this name and read the file from the
-        // method @readZipAvatars.
         String args[] = fileName.split("\\s+");
-        // ex: Julie = Julie
-        // Julie Assistant = Julie
-        // Its only going to take one name
-        try {
-//            GetAvatarAction avatar = new GetAvatarAction(activity);
-//            avatar.readZipFile(args[0] + ".zip");
-//            MicroConnection.avatarConfig = avatar.instance;
-        } catch (Exception ignore) {
-        }
     }
 }
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/PaphusCredentials.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/PaphusCredentials.java
deleted file mode 100644
index f895330e85d994cd02f5c2330396fbd149fa6c8f..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/PaphusCredentials.java
+++ /dev/null
@@ -1,39 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk;
-
-/**
- * Credentials for use with hosted services on the Bot Libre for Business website,
- * a commercial bot, live chat, chatroom, and forum hosting service.
- * https://www.botlibre.biz
- */
-public class PaphusCredentials extends Credentials {
-	public static String DOMAIN = "www.botlibre.biz";
-	//public static String DOMAIN = "192.168.0.11:9080";
-	public static String APP = "";
-	//public static String APP = "/livechat";
-	public static String PATH = "/rest/api";
-
-	public PaphusCredentials(String applicationId) {
-		this.host = DOMAIN;
-		this.app = APP;
-		this.url = "https://" + DOMAIN + APP + PATH;
-		this.applicationId = applicationId;
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/SDKConnection.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
index a3e843091663cecbf38b86252de1c82cfa547778..266e751905b7cd4ca071ec34d7e2cbdc03d1f156 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
@@ -31,6 +31,7 @@ import com.franmontiel.persistentcookiejar.ClearableCookieJar;
 import com.franmontiel.persistentcookiejar.PersistentCookieJar;
 import com.franmontiel.persistentcookiejar.cache.SetCookieCache;
 import com.franmontiel.persistentcookiejar.persistence.SharedPrefsCookiePersistor;
+import ohos.agp.components.element.ShapeElement;
 import org.botlibre.sdk.config.AvatarConfig;
 import org.botlibre.sdk.config.AvatarMedia;
 import org.botlibre.sdk.config.AvatarMessage;
@@ -92,1916 +93,1693 @@ import javax.xml.parsers.DocumentBuilder;
 import javax.xml.parsers.DocumentBuilderFactory;
 
 /**
- * Connection class for a REST service connection.
- * The SDK connection gives you access to the paphus or libre server services using a REST API.
- * <p>
- * The services include:
- * <ul>
- * <li> User management (account creation, validation)
- * <li> Bot access, chat, and administration
- * <li> Forum access, posting, and administration
- * <li> Live chat access, chat, and administration
- * <li> Domain access, and administration
- * </ul>
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
  */
 public class SDKConnection {
-	protected static String[] types = new String[]{"Bots", "Forums", "Graphics", "Live Chat", "Domains", "Scripts", "IssueTracker"};
-	protected static String[] channelTypes = new String[]{"ChatRoom", "OneOnOne"};
-	protected static String[] accessModes = new String[]{"Everyone", "Users", "Members", "Administrators"};
-	protected static String[] mediaAccessModes = new String[]{"Everyone", "Users", "Members", "Administrators", "Disabled"};
-	protected static String[] learningModes = new String[]{"Disabled", "Administrators", "Users", "Everyone"};
-	protected static String[] correctionModes = new String[]{"Disabled", "Administrators", "Users", "Everyone"};
-	protected static String[] botModes = new String[]{"ListenOnly", "AnswerOnly", "AnswerAndListen"};
-	protected static String[] priorities = new String[]{"Low", "Medium", "High", "Sever"};
-	
-	protected String url;
-	protected UserConfig user;
-	protected DomainConfig domain;
-	protected Credentials credentials;
-	protected boolean debug = false;
-	
-	protected SDKException exception;
-
-	/**
-	 * Return the name of the default user image.
-	 */
-	public static String defaultUserImage() {
-		return "images/user-thumb.jpg";
-	}
-	
-	/**
-	 * Create an SDK connection.
-	 */
-	public SDKConnection() {
-	}
-	
-	/**
-	 * Create an SDK connection with the credentials.
-	 * Use the Credentials subclass specific to your server.
-	 */
-	public SDKConnection(Credentials credentials) {
-		this.credentials = credentials;
-		this.url = credentials.url;
-	}
-	
-	/**
-	 * Validate the user credentials (password, or token).
-	 * The user details are returned (with a connection token, password removed).
-	 * The user credentials are soted in the connection, and used on subsequent calls.
-	 * An SDKException is thrown if the connect failed.
-	 */
-	public UserConfig connect(UserConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/check-user", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			this.user = null;
-			return null;
-		}
-		try {
-			UserConfig user = new UserConfig();
-			user.parseXML(root);
-			this.user = user;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-		return this.user;
-	}
-	
-	/**
-	 * Execute the custom API.
-	 */
-	public Config custom(String api, Config config, Config result) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/" + api, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			result.parseXML(root);
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-		return result;
-	}
-	
-	/**
-	 * Connect to the live chat channel and return a LiveChatConnection.
-	 * A LiveChatConnection is separate from an SDKConnection and uses web sockets for
-	 * asynchronous communication.
-	 * The listener will be notified of all messages.
-	 */
-	public LiveChatConnection openLiveChat(ChannelConfig channel, LiveChatListener listener) {
-		LiveChatConnection connection = new LiveChatConnection(this.credentials, listener);
-		connection.connect(channel, this.user);
-		return connection;
-	}
-	
-	/**
-	 * Connect to the domain.
-	 * A domain is an isolated content space.
-	 * Any browse or query request will be specific to the domain's content.
-	 */	
-	public DomainConfig connect(DomainConfig config) {
-		this.domain = fetch(config);
-		return this.domain;
-	}
-	
-	/**
-	 * Disconnect from the connection.
-	 * An SDKConnection does not keep a live connection, but this resets its connected user and domain.
-	 */	
-	public void disconnect() {
-		this.user = null;
-		this.domain = null;
-	}
-	
-	/**
-	 * Fetch the user details.
-	 */	
-	public UserConfig fetch(UserConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/view-user", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			UserConfig user = new UserConfig();
-			user.parseXML(root);
-			return user;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Fetch the URL for the image from the server.
-	 */	
-	public URL fetchImage(String image) {
-		try {
-			return new URL("http://" + this.credentials.host + this.credentials.app + "/" + image);
-		} catch (Exception exception) {
-			this.exception = new SDKException(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Fetch the forum post details for the forum post id.
-	 */	
-	public ForumPostConfig fetch(ForumPostConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/check-forum-post", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ForumPostConfig post = new ForumPostConfig();
-			post.parseXML(root);
-			return post;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Fetch the issue details for the issue id.
-	 */
-	public IssueConfig fetch(IssueConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/check-issue", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			IssueConfig issue = new IssueConfig();
-			issue.parseXML(root);
-			return issue;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create a new user.
-	 */
-	public UserConfig create(Ability ability,UserConfig config) {
-		config.addCredentials(this);
-		String xml = POSTUpdate(ability,this.url + "/create-user", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			UserConfig user = new UserConfig();
-			user.parseXML(root);
-			this.user = user;
-			return user;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create a new forum post.
-	 * You must set the forum id for the post.
-	 */
-	public ForumPostConfig create(ForumPostConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/create-forum-post", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ForumPostConfig post = new ForumPostConfig();
-			post.parseXML(root);
-			return post;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new issue.
-	 * You must set the issue tracker id for the issue.
-	 */
-	public IssueConfig create(IssueConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/create-issue", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			IssueConfig issue = new IssueConfig();
-			issue.parseXML(root);
-			return issue;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new file/image/media attachment for a chat channel.
-	 */
-	public MediaConfig createChannelFileAttachment(String file, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTFILE(this.url + "/create-channel-attachment", file, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new image attachment for a chat channel.
-	 */
-	public MediaConfig createChannelImageAttachment(String file, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/create-channel-attachment", file, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new file/image/media attachment for an issue tracker.
-	 */
-	public MediaConfig createIssueTrackerFileAttachment(String file, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTFILE(this.url + "/create-issuetracker-attachment", file, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new image attachment for an issue tracker.
-	 */
-	public MediaConfig createIssueTrackerImageAttachment(String file, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/create-issuetracker-attachment", file, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new image attachment for an issue tracker.
-	 */
-	public MediaConfig createIssueTrackerImageAttachment(PixelMap bitmap, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/create-issuetracker-attachment", bitmap, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create a reply to a forum post.
-	 * You must set the parent id for the post replying to.
-	 */
-	public ForumPostConfig createReply(ForumPostConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/create-reply", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ForumPostConfig reply = new ForumPostConfig();
-			reply.parseXML(root);
-			return reply;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create a user message.
-	 * This can be used to send a user a direct message.
-	 * SPAM will cause your account to be deleted.
-	 */
-	public void createUserMessage(UserMessageConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/create-user-message", config.toXML());
-	}
-	
-	/**
-	 * Fetch the content details from the server.
-	 * The id or name and domain of the object must be set.
-	 */
-	@SuppressWarnings("unchecked")
-	public <T extends WebMediumConfig> T fetch(T config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/check-" + config.getType(), config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = (T)config.getClass().newInstance();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create the new content.
-	 * The content will be returned with its new id.
-	 */
-	@SuppressWarnings("unchecked")
-	public <T extends WebMediumConfig> T create(T config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/create-" + config.getType(), config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = (T)config.getClass().newInstance();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Update the content.
-	 */
-	@SuppressWarnings("unchecked")
-	public <T extends WebMediumConfig> T update(T config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/update-" + config.getType(), config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = (T)config.getClass().newInstance();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Update the forum post.
-	 */
-	public ForumPostConfig update(ForumPostConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/update-forum-post", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = new ForumPostConfig();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Update the issue.
-	 */
-	public IssueConfig update(IssueConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/update-issue", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = new IssueConfig();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create or update the response.
-	 * This can also be used to flag, unflag, validate, or invalidate a response.
-	 */
-	public ResponseConfig saveResponse(ResponseConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/save-response", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ResponseConfig response = new ResponseConfig();
-			response.parseXML(root);
-			return response;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Update the user details.
-	 * The password must be passed to allow the update.
-	 */
-	public UserConfig update(UserConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/update-user", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			UserConfig user = new UserConfig();
-			user.parseXML(root);
-			this.user = user;
-			return user;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Permanently delete the content with the id.
-	 */
-	public void delete(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-" + config.getType(), config.toXML());
-		if(this.domain!=null && this.domain.id.equals(config.id) && config.getType().equals("domain") ){
-			domain=null;
-		}
-	}
-	
-	/**
-	 * Permanently delete the forum post with the id.
-	 */
-	public void delete(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-forum-post", config.toXML());
-	}
-
-	/**
-	 * Permanently delete the issue with the id.
-	 */
-	public void delete(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-issue", config.toXML());
-	}
-	
-	/**
-	 * Permanently delete the response, greetings, or default response with the response id (and question id).
-	 */
-	public void delete(ResponseConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-response", config.toXML());
-	}
-	
-	/**
-	 * Permanently delete the avatar media.
-	 */
-	public void delete(AvatarMedia config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-avatar-media", config.toXML());
-	}
-	
-	/**
-	 * Permanently delete the avatar background.
-	 */
-	public void deleteAvatarBackground(AvatarConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-avatar-background", config.toXML());
-	}
-	
-	/**
-	 * Save the avatar media tags.
-	 */
-	public void saveAvatarMedia(AvatarMedia config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-avatar-media", config.toXML());
-	}
-	
-	/**
-	 * Flag the content as offensive, a reason is required.
-	 */
-	public void flag(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/flag-" + config.getType(), config.toXML());
-	}
-	
-	/**
-	 * Subscribe for email updates for the post.
-	 */
-	public void subscribe(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/subscribe-post", config.toXML());
-	}
-
-	/**
-	 * Subscribe for email updates for the issue.
-	 */
-	public void subscribe(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/subscribe-issue", config.toXML());
-	}
-	
-	/**
-	 * Subscribe for email updates for the forum.
-	 */
-	public void subscribe(ForumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/subscribe-forum", config.toXML());
-	}
-	
-	/**
-	 * Unsubscribe from email updates for the post.
-	 */
-	public void unsubscribe(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/unsubscribe-post", config.toXML());
-	}
-
-	/**
-	 * Unsubscribe from email updates for the issue.
-	 */
-	public void unsubscribe(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/unsubscribe-issue", config.toXML());
-	}
-	
-	/**
-	 * Unsubscribe from email updates for the forum.
-	 */
-	public void unsubscribe(ForumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/unsubscribe-forum", config.toXML());
-	}
-	
-	/**
-	 * Thumbs up the content.
-	 */
-	public void thumbsUp(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-up-" + config.getType(), config.toXML());
-	}
-	
-	/**
-	 * Thumbs down the content.
-	 */
-	public void thumbsDown(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-down-" + config.getType(), config.toXML());
-	}
-	
-	/**
-	 * Rate the content.
-	 */
-	public void star(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/star-" + config.getType(), config.toXML());
-	}
-	
-	/**
-	 * Thumbs up the content.
-	 */
-	public void thumbsUp(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-up-post", config.toXML());
-	}
-	
-	/**
-	 * Thumbs down the content.
-	 */
-	public void thumbsDown(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-down-post", config.toXML());
-	}
-	
-	/**
-	 * Rate the content.
-	 */
-	public void star(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/star-post", config.toXML());
-	}
-	
-	/**
-	 * Flag the forum post as offensive, a reason is required.
-	 */
-	public void flag(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/flag-forum-post", config.toXML());
-	}
-
-	/**
-	 * Thumbs up the content.
-	 */
-	public void thumbsUp(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-up-issue", config.toXML());
-	}
-
-	/**
-	 * Thumbs down the content.
-	 */
-	public void thumbsDown(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-down-issue", config.toXML());
-	}
-
-	/**
-	 * Rate the content.
-	 */
-	public void star(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/star-issue", config.toXML());
-	}
-
-	/**
-	 * Flag the forum post as offensive, a reason is required.
-	 */
-	public void flag(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/flag-issue", config.toXML());
-	}
-	
-	/**
-	 * Flag the user post as offensive, a reason is required.
-	 */
-	public void flag(UserConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/flag-user", config.toXML());
-	}
-	
-	/**
-	 * Process the bot chat message and return the bot's response.
-	 * The ChatConfig should contain the conversation id if part of a conversation.
-	 * If a new conversation the conversation id is returned in the response. 
-	 */
-	public ChatResponse chat(ChatConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/post-chat", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ChatResponse response = new ChatResponse();
-			response.parseXML(root);
-			return response;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Process the avatar message and return the avatars response.
-	 * This allows the speech and video animation for an avatar to be generated for the message.
-	 */
-	public ChatResponse avatarMessage(AvatarMessage config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/avatar-message", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ChatResponse response = new ChatResponse();
-			response.parseXML(root);
-			return response;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Process the speech message and return the server generate text-to-speech audio file.
-	 * This allows for server-side speech generation.
-	 */
-	public String tts(Speech config) {
-		config.addCredentials(this);
-		return POST(this.url + "/speak", config.toXML());
-	}
-	
-	/**
-	 * Return the administrators of the content.
-	 */
-	public List<String> getAdmins(WebMediumConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-" + config.getType() + "-admins", config.toXML());
-		List<String> users = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return users;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			UserConfig user = new UserConfig();
-			user.parseXML((Element)root.getChildNodes().item(index));
-			users.add(user.user);
-		}
-		return users;
-	}
-	
-	/**
-	 * Return the list of user details for the comma separated values list of user ids.
-	 */
-	public List<UserConfig> getUsers(String usersCSV) {
-		UserConfig config = new UserConfig();
-		config.user = usersCSV;
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-users", config.toXML());
-		List<UserConfig> users = new ArrayList<UserConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return users;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			Element child = (Element)root.getChildNodes().item(index);
-			UserConfig userConfig = new UserConfig();
-			userConfig.parseXML(child);
-			users.add(userConfig);
-		}
-		return users;
-	}
-	
-	/**
-	 * Return the list of forum posts for the forum browse criteria.
-	 */
-	public List<ForumPostConfig> getPosts(BrowseConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-forum-posts", config.toXML());
-		List<ForumPostConfig> instances = new ArrayList<ForumPostConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return instances;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			ForumPostConfig post = new ForumPostConfig();
-			post.parseXML((Element)root.getChildNodes().item(index));
-			instances.add(post);
-		}
-		return instances;
-	}
-
-	/**
-	 * Return the list of issues for the issue tracker browse criteria.
-	 */
-	public List<IssueConfig> getIssues(BrowseConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-issues", config.toXML());
-		List<IssueConfig> instances = new ArrayList<IssueConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return instances;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			IssueConfig issue = new IssueConfig();
-			issue.parseXML((Element)root.getChildNodes().item(index));
-			instances.add(issue);
-		}
-		return instances;
-	}
-	
-	/**
-	 * Return the list of categories for the type, and domain.
-	 */
-	public List<ContentConfig> getCategories(ContentConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-categories", config.toXML());
-		List<ContentConfig> categories = new ArrayList<ContentConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return categories;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			ContentConfig category = new ContentConfig();
-			category.parseXML((Element)root.getChildNodes().item(index));
-			categories.add(category);
-		}
-		return categories;
-	}
-	
-	/**
-	 * Return the list of tags for the type, and domain.
-	 */
-	public List<String> getTags(ContentConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-tags", config.toXML());
-		List<String> tags = new ArrayList<String>();
-		tags.add("");
-		Element root = parse(xml);
-		if (root == null) {
-			return tags;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			tags.add(((Element)root.getChildNodes().item(index)).getAttribute("name"));
-		}
-		return tags;
-	}
-	
-	/**
-	  * Return the list of bot templates.
-	  */
-	
-	//return the list of templates with the pictures.
-	 public List<InstanceConfig> getTemplates() {
-	  String xml = GET(this.url + "/get-all-templates");
-	  List<InstanceConfig> instances = new ArrayList<InstanceConfig>();
-	  Element root = parse(xml);
-	  if (root == null) {
-	   return instances;
-	  }
-	  for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-	   InstanceConfig instance = new InstanceConfig();
-	   instance.parseXML((Element)root.getChildNodes().item(index));
-	   instances.add(instance);
-	  }
-	  return instances;
-	 }
-	
-	/**
-	 * Return the users for the content.
-	 */
-	public List<String> getUsers(WebMediumConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-" + config.getType() + "-users", config.toXML());
-		List<String> users = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return users;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			UserConfig user = new UserConfig();
-			user.parseXML((Element)root.getChildNodes().item(index));
-			users.add(user.user);
-		}
-		return users;
-	}
-	
-	/**
-	 * Return the channel's bot configuration.
-	 */
-	public BotModeConfig getChannelBotMode(ChannelConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-channel-bot-mode", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			BotModeConfig botMode = new BotModeConfig();
-			botMode.parseXML(root);
-			return botMode;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Save the channel's bot configuration.
-	 */
-	public void saveChannelBotMode(BotModeConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-channel-bot-mode", config.toXML());
-	}
-	
-	/**
-	 * Save the forum's bot configuration.
-	 */
-	public void saveForumBotMode(BotModeConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-forum-bot-mode", config.toXML());
-	}
-	
-	/**
-	 * Save the bot's learning configuration.
-	 */
-	public void saveLearning(LearningConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-learning", config.toXML());
-	}
-	
-	/**
-	 * Save the bot's voice configuration.
-	 */
-	public void saveVoice(VoiceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-voice", config.toXML());
-	}
-	
-	/**
-	 * Save the bot's avatar configuration.
-	 */
-	public void saveBotAvatar(InstanceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-bot-avatar", config.toXML());
-	}
-	
-	/**
-	 * Train the bot with a new question/response pair.
-	 */
-	public void train(TrainingConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/train-instance", config.toXML());
-	}
-	
-	/**
-	 * Perform the user administration task (add or remove users, or administrators).
-	 */
-	public void userAdmin(UserAdminConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/user-admin", config.toXML());
-	}
-	
-	/**
-	 * Save the image as the avatar's background.
-	 */
-	public void saveAvatarBackground(String file, AvatarMedia config) {
-		config.addCredentials(this);
-		POSTIMAGE(this.url + "/save-avatar-background", file, config.name, config.toXML());
-	}
-	
-	/**
-	 * Add the avatar media file to the avatar.
-	 */
-	public void createAvatarMedia(String file, AvatarMedia config) {
-		config.addCredentials(this);
-		if ((file.indexOf(".jpg") != -1) || (file.indexOf(".jpeg") != -1)) {
-			if (config.hd) {
-				POSTHDIMAGE(this.url + "/create-avatar-media", file, config.name, config.toXML());
-			} else {
-				POSTIMAGE(this.url + "/create-avatar-media", file, config.name, config.toXML());
-			}
-		} else {
-			POSTFILE(this.url + "/create-avatar-media", file, config.name, config.toXML());
-		}
-	}
-	/**
-	 * Add the graphic media file to the graphic.
-	 */
-	public void createGraphicMedia(String file, GraphicConfig config) {
-		config.addCredentials(this);
-		if ((file.indexOf(".jpg") != -1) || (file.indexOf(".jpeg") != -1)) {
-			POSTIMAGE(this.url + "/update-graphic-media", file, config.fileName, config.toXML());
-		} else {
-			POSTFILE(this.url + "/update-graphic-media", file, config.fileName, config.toXML());
-		}
-	}
-	/**
-	 * Update the contents icon.
-	 * The file will be uploaded to the server.
-	 */
-	@SuppressWarnings("unchecked")
-	public <T extends WebMediumConfig> T updateIcon(String file, T config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/update-" + config.getType() + "-icon", file, "image.jpg", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = (T)config.getClass().newInstance();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Update the user's icon.
-	 * The file will be uploaded to the server.
-	 */
-	public UserConfig updateIcon(String file, UserConfig config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/update-user-icon", file, "image.jpg", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = new UserConfig();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	public String POSTIMAGE(String url, String file, String name, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("file: " + file);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-//		try { //=====================
-//			Bitmap bitmap = loadImage(file, 600, 600);
-//	        ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//	        bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream);
-//	        byte[] byte_arr = stream.toByteArray();
-//	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-//
-//	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-//
-//	        multipartEntity.addPart("file", fileBody);
-//	        multipartEntity.addPart("xml", new StringBody(xml));
-//
-//	        HttpClient httpclient = new DefaultHttpClient();
-//	        HttpResponse response = null;
-//
-//            HttpPost httppost = new HttpPost(url);
-//            httppost.setEntity(multipartEntity);
-//            response = httpclient.execute(httppost);
-//
-//			HttpEntity entity = response.getEntity();
-//			if (entity != null) {
-//				result = EntityUtils.toString(entity, HTTP.UTF_8);
-//			}
-//
-//			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-//				this.exception = new SDKException(""
-//				   + response.getStatusLine().getStatusCode()
-//				   + " : " + result);
-//	 			throw this.exception;
-//			}
-//
-//        } catch (Exception exception) {
-// 			this.exception = new SDKException(exception);
-// 			throw this.exception;
-// 		}
- 		return result;
-	}
-
-	public String POSTIMAGE(String url, PixelMap bitmap, String name, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		try {
-			ByteArrayOutputStream stream = new ByteArrayOutputStream();
+    protected static String[] types = new String[]{"Bots", "Forums", "Graphics", "Live Chat", "Domains", "Scripts", "IssueTracker"};
+    protected static String[] channelTypes = new String[]{"ChatRoom", "OneOnOne"};
+    protected static String[] accessModes = new String[]{"Everyone", "Users", "Members", "Administrators"};
+    protected static String[] mediaAccessModes = new String[]{"Everyone", "Users", "Members", "Administrators", "Disabled"};
+    protected static String[] learningModes = new String[]{"Disabled", "Administrators", "Users", "Everyone"};
+    protected static String[] correctionModes = new String[]{"Disabled", "Administrators", "Users", "Everyone"};
+    protected static String[] botModes = new String[]{"ListenOnly", "AnswerOnly", "AnswerAndListen"};
+    protected static String[] priorities = new String[]{"Low", "Medium", "High", "Sever"};
+
+    protected String url;
+    protected UserConfig user;
+    protected DomainConfig domain;
+    protected Credentials credentials;
+    protected boolean debug = false;
+
+    protected SDKException exception;
+
+    /**
+     * Return the name of the default user image.
+     */
+    public static String defaultUserImage() {
+        return "images/user-thumb.jpg";
+    }
+
+    /**
+     * Create an SDK connection.
+     */
+    public SDKConnection() {
+    }
+
+    /**
+     * Create an SDK connection with the credentials.
+     * Use the Credentials subclass specific to your server.
+     */
+    public SDKConnection(Credentials credentials) {
+        this.credentials = credentials;
+        this.url = credentials.url;
+    }
+
+    /**
+     * connect
+     *
+     * @param config
+     * @return
+     */
+    public UserConfig connect(UserConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/check-user", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            this.user = null;
+            return null;
+        }
+        try {
+            UserConfig user = new UserConfig();
+            user.parseXML(root);
+            this.user = user;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+        return this.user;
+    }
+
+    /**
+     * custom
+     *
+     * @param api
+     * @param config
+     * @param result
+     * @return dd
+     */
+    public Config custom(String api, Config config, Config result) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/" + api, config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            result.parseXML(root);
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+        return result;
+    }
+
+
+    /**
+     * connect
+     *
+     * @param config
+     * @return dd
+     */
+    public DomainConfig connect(DomainConfig config) {
+        this.domain = fetch(config);
+        return this.domain;
+    }
+
+    /**
+     * disconnect
+     */
+    public void disconnect() {
+        this.user = null;
+        this.domain = null;
+    }
+
+    /**
+     * fetch
+     *
+     * @param config
+     * @return dsd
+     */
+    public UserConfig fetch(UserConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/view-user", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            UserConfig user = new UserConfig();
+            user.parseXML(root);
+            return user;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * fetchImage
+     *
+     * @param image
+     * @return dd
+     */
+    public URL fetchImage(String image) {
+        try {
+            return new URL("http://" + this.credentials.host + this.credentials.app + "/" + image);
+        } catch (Exception exception) {
+            this.exception = new SDKException(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * fetch
+     *
+     * @param config
+     * @return dd
+     */
+    public ForumPostConfig fetch(ForumPostConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/check-forum-post", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            ForumPostConfig post = new ForumPostConfig();
+            post.parseXML(root);
+            return post;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * fetch
+     *
+     * @param config
+     * @return dd
+     */
+    public IssueConfig fetch(IssueConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/check-issue", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            IssueConfig issue = new IssueConfig();
+            issue.parseXML(root);
+            return issue;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * create
+     *
+     * @param ability
+     * @param config
+     * @return df
+     */
+    public UserConfig create(Ability ability, UserConfig config) {
+        config.addCredentials(this);
+        String xml = POSTUpdate(ability, this.url + "/create-user", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            UserConfig user = new UserConfig();
+            user.parseXML(root);
+            this.user = user;
+            return user;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * create
+     *
+     * @param config
+     * @return dd
+     */
+    public ForumPostConfig create(ForumPostConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/create-forum-post", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            ForumPostConfig post = new ForumPostConfig();
+            post.parseXML(root);
+            return post;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * create
+     *
+     * @param config
+     * @return dd
+     */
+    public IssueConfig create(IssueConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/create-issue", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            IssueConfig issue = new IssueConfig();
+            issue.parseXML(root);
+            return issue;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * createChannelFileAttachment
+     *
+     * @param file
+     * @param config
+     * @return
+     */
+    public MediaConfig createChannelFileAttachment(String file, MediaConfig config) {
+        config.addCredentials(this);
+        String xml = POSTFILE(this.url + "/create-channel-attachment", file, config.name, config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            MediaConfig media = new MediaConfig();
+            media.parseXML(root);
+            return media;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * createChannelImageAttachment
+     *
+     * @param file
+     * @param config
+     * @return dd
+     */
+    public MediaConfig createChannelImageAttachment(String file, MediaConfig config) {
+        config.addCredentials(this);
+        String xml = POSTIMAGE(this.url + "/create-channel-attachment", file, config.name, config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            MediaConfig media = new MediaConfig();
+            media.parseXML(root);
+            return media;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * createIssueTrackerFileAttachment
+     *
+     * @param file
+     * @param config
+     * @return dd
+     */
+    public MediaConfig createIssueTrackerFileAttachment(String file, MediaConfig config) {
+        config.addCredentials(this);
+        String xml = POSTFILE(this.url + "/create-issuetracker-attachment", file, config.name, config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            MediaConfig media = new MediaConfig();
+            media.parseXML(root);
+            return media;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * createIssueTrackerImageAttachment
+     *
+     * @param file
+     * @param config
+     * @return dd
+     */
+    public MediaConfig createIssueTrackerImageAttachment(String file, MediaConfig config) {
+        config.addCredentials(this);
+        String xml = POSTIMAGE(this.url + "/create-issuetracker-attachment", file, config.name, config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            MediaConfig media = new MediaConfig();
+            media.parseXML(root);
+            return media;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * createIssueTrackerImageAttachment
+     *
+     * @param bitmap
+     * @param config
+     * @return dd
+     */
+    public MediaConfig createIssueTrackerImageAttachment(PixelMap bitmap, MediaConfig config) {
+        config.addCredentials(this);
+        String xml = POSTIMAGE(this.url + "/create-issuetracker-attachment", bitmap, config.name, config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            MediaConfig media = new MediaConfig();
+            media.parseXML(root);
+            return media;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * createReply
+     *
+     * @param config
+     * @return dd
+     */
+    public ForumPostConfig createReply(ForumPostConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/create-reply", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            ForumPostConfig reply = new ForumPostConfig();
+            reply.parseXML(root);
+            return reply;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * fetch
+     *
+     * @param config
+     * @param <T>
+     * @return dd
+     */
+    public <T extends WebMediumConfig> T fetch(T config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/check-" + config.getType(), config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            config = (T) config.getClass().newInstance();
+            config.parseXML(root);
+            return config;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * create
+     *
+     * @param config
+     * @param <T>
+     * @return
+     */
+    public <T extends WebMediumConfig> T create(T config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/create-" + config.getType(), config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            config = (T) config.getClass().newInstance();
+            config.parseXML(root);
+            return config;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * update
+     *
+     * @param config
+     * @param <T>
+     * @return
+     */
+    public <T extends WebMediumConfig> T update(T config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/update-" + config.getType(), config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            config = (T) config.getClass().newInstance();
+            config.parseXML(root);
+            return config;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+
+    /**
+     * saveResponse
+     *
+     * @param config
+     * @return
+     */
+    public ResponseConfig saveResponse(ResponseConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/save-response", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            ResponseConfig response = new ResponseConfig();
+            response.parseXML(root);
+            return response;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+
+    /**
+     * delete
+     *
+     * @param config
+     */
+    public void delete(WebMediumConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-" + config.getType(), config.toXML());
+        if (this.domain != null && this.domain.id.equals(config.id) && config.getType().equals("domain")) {
+            domain = null;
+        }
+    }
+
+    /**
+     * delete
+     *
+     * @param config
+     */
+    public void delete(ForumPostConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-forum-post", config.toXML());
+    }
+
+    /**
+     * delete
+     *
+     * @param config
+     */
+    public void delete(IssueConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-issue", config.toXML());
+    }
+
+    /**
+     * delete
+     *
+     * @param config
+     */
+    public void delete(ResponseConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-response", config.toXML());
+    }
+
+    /**
+     * delete
+     *
+     * @param config
+     */
+    public void delete(AvatarMedia config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-avatar-media", config.toXML());
+    }
+
+    /**
+     * deleteAvatarBackground
+     *
+     * @param config
+     */
+    public void deleteAvatarBackground(AvatarConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-avatar-background", config.toXML());
+    }
+
+    /**
+     * saveAvatarMedia
+     *
+     * @param config
+     */
+    public void saveAvatarMedia(AvatarMedia config) {
+        config.addCredentials(this);
+        POST(this.url + "/save-avatar-media", config.toXML());
+    }
+
+
+    /**
+     * subscribe
+     *
+     * @param config
+     */
+    public void subscribe(ForumPostConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/subscribe-post", config.toXML());
+    }
+
+    /**
+     * subscribe
+     *
+     * @param config
+     */
+    public void subscribe(IssueConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/subscribe-issue", config.toXML());
+    }
+
+    /**
+     * subscribe
+     *
+     * @param config
+     */
+    public void subscribe(ForumConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/subscribe-forum", config.toXML());
+    }
+
+
+    /**
+     * thumbsUp
+     *
+     * @param config
+     */
+    public void thumbsUp(WebMediumConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/thumbs-up-" + config.getType(), config.toXML());
+    }
+
+    /**
+     * thumbsDown
+     *
+     * @param config
+     */
+    public void thumbsDown(WebMediumConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/thumbs-down-" + config.getType(), config.toXML());
+    }
+
+    /**
+     * star
+     *
+     * @param config
+     */
+    public void star(WebMediumConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/star-" + config.getType(), config.toXML());
+    }
+
+    /**
+     * thumbsUp
+     *
+     * @param config
+     */
+    public void thumbsUp(ForumPostConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/thumbs-up-post", config.toXML());
+    }
+
+    /**
+     * thumbsDown
+     *
+     * @param config
+     */
+    public void thumbsDown(ForumPostConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/thumbs-down-post", config.toXML());
+    }
+
+    /**
+     * star
+     *
+     * @param config
+     */
+    public void star(ForumPostConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/star-post", config.toXML());
+    }
+
+
+    /**
+     * thumbsUp
+     *
+     * @param config
+     */
+    public void thumbsUp(IssueConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/thumbs-up-issue", config.toXML());
+    }
+
+    /**
+     * thumbsDown
+     *
+     * @param config
+     */
+    public void thumbsDown(IssueConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/thumbs-down-issue", config.toXML());
+    }
+
+    /**
+     * star
+     *
+     * @param config
+     */
+    public void star(IssueConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/star-issue", config.toXML());
+    }
+
+
+    /**
+     * flag
+     *
+     * @param config
+     */
+    public void flag(UserConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/flag-user", config.toXML());
+    }
+
+    /**
+     * chat
+     *
+     * @param config
+     * @return
+     */
+    public ChatResponse chat(ChatConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/post-chat", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            ChatResponse response = new ChatResponse();
+            response.parseXML(root);
+            return response;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * avatarMessage
+     *
+     * @param config
+     * @return
+     */
+    public ChatResponse avatarMessage(AvatarMessage config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/avatar-message", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            ChatResponse response = new ChatResponse();
+            response.parseXML(root);
+            return response;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * getAdmins
+     *
+     * @param config
+     * @return
+     */
+    public List<String> getAdmins(WebMediumConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-" + config.getType() + "-admins", config.toXML());
+        List<String> users = new ArrayList<String>();
+        Element root = parse(xml);
+        if (root == null) {
+            return users;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            UserConfig user = new UserConfig();
+            user.parseXML((Element) root.getChildNodes().item(index));
+            users.add(user.user);
+        }
+        return users;
+    }
+
+    /**
+     * getUsers
+     *
+     * @param usersCSV
+     * @return
+     */
+    public List<UserConfig> getUsers(String usersCSV) {
+        UserConfig config = new UserConfig();
+        config.user = usersCSV;
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-users", config.toXML());
+        List<UserConfig> users = new ArrayList<UserConfig>();
+        Element root = parse(xml);
+        if (root == null) {
+            return users;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            Element child = (Element) root.getChildNodes().item(index);
+            UserConfig userConfig = new UserConfig();
+            userConfig.parseXML(child);
+            users.add(userConfig);
+        }
+        return users;
+    }
+
+    /**
+     * getPosts
+     *
+     * @param config
+     * @return
+     */
+    public List<ForumPostConfig> getPosts(BrowseConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-forum-posts", config.toXML());
+        List<ForumPostConfig> instances = new ArrayList<ForumPostConfig>();
+        Element root = parse(xml);
+        if (root == null) {
+            return instances;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            ForumPostConfig post = new ForumPostConfig();
+            post.parseXML((Element) root.getChildNodes().item(index));
+            instances.add(post);
+        }
+        return instances;
+    }
+
+    /**
+     * getIssues
+     *
+     * @param config
+     * @return
+     */
+    public List<IssueConfig> getIssues(BrowseConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-issues", config.toXML());
+        List<IssueConfig> instances = new ArrayList<IssueConfig>();
+        Element root = parse(xml);
+        if (root == null) {
+            return instances;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            IssueConfig issue = new IssueConfig();
+            issue.parseXML((Element) root.getChildNodes().item(index));
+            instances.add(issue);
+        }
+        return instances;
+    }
+
+    /**
+     * getCategories
+     *
+     * @param config
+     * @return
+     */
+    public List<ContentConfig> getCategories(ContentConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-categories", config.toXML());
+        List<ContentConfig> categories = new ArrayList<ContentConfig>();
+        Element root = parse(xml);
+        if (root == null) {
+            return categories;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            ContentConfig category = new ContentConfig();
+            category.parseXML((Element) root.getChildNodes().item(index));
+            categories.add(category);
+        }
+        return categories;
+    }
+
+    /**
+     * getTags
+     *
+     * @param config
+     * @return
+     */
+    public List<String> getTags(ContentConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-tags", config.toXML());
+        List<String> tags = new ArrayList<String>();
+        tags.add("");
+        Element root = parse(xml);
+        if (root == null) {
+            return tags;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            tags.add(((Element) root.getChildNodes().item(index)).getAttribute("name"));
+        }
+        return tags;
+    }
+
+    /**
+     * getTemplates
+     *
+     * @return
+     */
+    public List<InstanceConfig> getTemplates() {
+        String xml = GET(this.url + "/get-all-templates");
+        List<InstanceConfig> instances = new ArrayList<InstanceConfig>();
+        Element root = parse(xml);
+        if (root == null) {
+            return instances;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            InstanceConfig instance = new InstanceConfig();
+            instance.parseXML((Element) root.getChildNodes().item(index));
+            instances.add(instance);
+        }
+        return instances;
+    }
+
+    /**
+     * getUsers
+     *
+     * @param config
+     * @return
+     */
+    public List<String> getUsers(WebMediumConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-" + config.getType() + "-users", config.toXML());
+        List<String> users = new ArrayList<String>();
+        Element root = parse(xml);
+        if (root == null) {
+            return users;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            UserConfig user = new UserConfig();
+            user.parseXML((Element) root.getChildNodes().item(index));
+            users.add(user.user);
+        }
+        return users;
+    }
+
+    /**
+     * saveChannelBotMode
+     *
+     * @param config
+     */
+    public void saveChannelBotMode(BotModeConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/save-channel-bot-mode", config.toXML());
+    }
+
+    /**
+     * saveForumBotMode
+     *
+     * @param config
+     */
+    public void saveForumBotMode(BotModeConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/save-forum-bot-mode", config.toXML());
+    }
+
+
+    /**
+     * saveVoice
+     *
+     * @param config
+     */
+    public void saveVoice(VoiceConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/save-voice", config.toXML());
+    }
+
+    /**
+     * saveBotAvatar
+     *
+     * @param config
+     */
+    public void saveBotAvatar(InstanceConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/save-bot-avatar", config.toXML());
+    }
+
+    /**
+     * saveAvatarBackground
+     *
+     * @param file
+     * @param config
+     */
+    public void saveAvatarBackground(String file, AvatarMedia config) {
+        config.addCredentials(this);
+        POSTIMAGE(this.url + "/save-avatar-background", file, config.name, config.toXML());
+    }
+
+    /**
+     * createAvatarMedia
+     *
+     * @param file
+     * @param config
+     */
+    public void createAvatarMedia(String file, AvatarMedia config) {
+        config.addCredentials(this);
+        if ((file.indexOf(".jpg") != -1) || (file.indexOf(".jpeg") != -1)) {
+            if (config.hd) {
+                POSTHDIMAGE(this.url + "/create-avatar-media", file, config.name, config.toXML());
+            } else {
+                POSTIMAGE(this.url + "/create-avatar-media", file, config.name, config.toXML());
+            }
+        } else {
+            POSTFILE(this.url + "/create-avatar-media", file, config.name, config.toXML());
+        }
+    }
+
+    /**
+     * createGraphicMedia
+     *
+     * @param file
+     * @param config
+     */
+    public void createGraphicMedia(String file, GraphicConfig config) {
+        config.addCredentials(this);
+        if ((file.indexOf(".jpg") != -1) || (file.indexOf(".jpeg") != -1)) {
+            POSTIMAGE(this.url + "/update-graphic-media", file, config.fileName, config.toXML());
+        } else {
+            POSTFILE(this.url + "/update-graphic-media", file, config.fileName, config.toXML());
+        }
+    }
+
+    /**
+     * updateIcon
+     *
+     * @param file
+     * @param config
+     * @param <T>
+     * @return
+     */
+    public <T extends WebMediumConfig> T updateIcon(String file, T config) {
+        config.addCredentials(this);
+        String xml = POSTIMAGE(this.url + "/update-" + config.getType() + "-icon", file, "image.jpg", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            config = (T) config.getClass().newInstance();
+            config.parseXML(root);
+            return config;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * updateIcon
+     *
+     * @param file
+     * @param config
+     * @return
+     */
+    public UserConfig updateIcon(String file, UserConfig config) {
+        config.addCredentials(this);
+        String xml = POSTIMAGE(this.url + "/update-user-icon", file, "image.jpg", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            config = new UserConfig();
+            config.parseXML(root);
+            return config;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * POSTIMAGE
+     *
+     * @param url
+     * @param file
+     * @param name
+     * @param xml
+     * @return
+     */
+    public String POSTIMAGE(String url, String file, String name, String xml) {
+        if (this.debug) {
+            System.out.println("POST: " + url);
+            System.out.println("file: " + file);
+            System.out.println("XML: " + xml);
+        }
+        String result = "";
+        return result;
+    }
+
+    /**
+     * POSTIMAGE
+     *
+     * @param url
+     * @param bitmap
+     * @param name
+     * @param xml
+     * @return
+     */
+    public String POSTIMAGE(String url, PixelMap bitmap, String name, String xml) {
+        if (this.debug) {
+            System.out.println("POST: " + url);
+            System.out.println("XML: " + xml);
+        }
+        String result = "";
+        try {
+            ByteArrayOutputStream stream = new ByteArrayOutputStream();
 //			bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream); //=====================
-			byte[] byte_arr = stream.toByteArray();
-			ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-
-			MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-
-			multipartEntity.addPart("file", fileBody);
-			multipartEntity.addPart("xml", new StringBody(xml));
-
-			HttpClient httpclient = new DefaultHttpClient();
-			HttpResponse response = null;
-
-			HttpPost httppost = new HttpPost(url);
-			httppost.setEntity(multipartEntity);
-			response = httpclient.execute(httppost);
-
-			HttpEntity entity = response.getEntity();
-			if (entity != null) {
-				result = EntityUtils.toString(entity, HTTP.UTF_8);
-			}
-
-			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-				this.exception = new SDKException(""
-						+ response.getStatusLine().getStatusCode()
-						+ " : " + result);
-				throw this.exception;
-			}
-
-		} catch (Exception exception) {
-			this.exception = new SDKException(exception);
-			throw this.exception;
-		}
-		return result;
-	}
-	
-	public String POSTHDIMAGE(String url, String file, String name, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("file: " + file);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		try {
-//			Bitmap bitmap = loadImage(file, 600, 600);  //=====================
-//	        ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//	        bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream);
-//	        byte[] byte_arr = stream.toByteArray();
-//	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-//
-//	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-//
-//	        multipartEntity.addPart("file", fileBody);
-//	        multipartEntity.addPart("xml", new StringBody(xml));
-//
-//	        HttpClient httpclient = new DefaultHttpClient();
-//	        HttpResponse response = null;
-//
-//            HttpPost httppost = new HttpPost(url);
-//            httppost.setEntity(multipartEntity);
-//            response = httpclient.execute(httppost);
-//
-//			HttpEntity entity = response.getEntity();
-//			if (entity != null) {
-//				result = EntityUtils.toString(entity, HTTP.UTF_8);
-//			}
-//
-//			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-//				this.exception = new SDKException(""
-//				   + response.getStatusLine().getStatusCode()
-//				   + " : " + result);
-//	 			throw this.exception;
-//			}
+            byte[] byte_arr = stream.toByteArray();
+            ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
+
+            MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
+
+            multipartEntity.addPart("file", fileBody);
+            multipartEntity.addPart("xml", new StringBody(xml));
+
+            HttpClient httpclient = new DefaultHttpClient();
+            HttpResponse response = null;
+
+            HttpPost httppost = new HttpPost(url);
+            httppost.setEntity(multipartEntity);
+            response = httpclient.execute(httppost);
+
+            HttpEntity entity = response.getEntity();
+            if (entity != null) {
+                result = EntityUtils.toString(entity, HTTP.UTF_8);
+            }
+
+            if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
+                this.exception = new SDKException(""
+                        + response.getStatusLine().getStatusCode()
+                        + " : " + result);
+                throw this.exception;
+            }
+
+        } catch (Exception exception) {
+            this.exception = new SDKException(exception);
+            throw this.exception;
+        }
+        return result;
+    }
+
+    /**
+     * POSTHDIMAGE
+     *
+     * @param url
+     * @param file
+     * @param name
+     * @param xml
+     * @return
+     */
+    public String POSTHDIMAGE(String url, String file, String name, String xml) {
+        if (this.debug) {
+            System.out.println("POST: " + url);
+            System.out.println("file: " + file);
+            System.out.println("XML: " + xml);
+        }
+        String result = "";
+        try {
 
         } catch (Exception exception) {
- 			this.exception = new SDKException(exception);
- 			throw this.exception;
- 		}
- 		return result;
-	}
-	
-	public String POSTFILE(String url, String path, String name, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("file: " + path);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		try {
-			File file = new File(path);
-			FileInputStream stream = new FileInputStream(file);
-			ByteArrayOutputStream output = new ByteArrayOutputStream();
-			int read = 0;
-	        byte[] buffer = new byte[4096];
-	        while ((read = stream.read(buffer)) != -1 ) {
-	        	output.write(buffer, 0, read);
-	        }
-	        byte[] byte_arr = output.toByteArray();
-	        stream.close();
-	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-	
-	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-	
-	        multipartEntity.addPart("file", fileBody);
-	        multipartEntity.addPart("xml", new StringBody(xml));
-	
-	        HttpClient httpclient = new DefaultHttpClient();
-	        HttpResponse response = null;
+            this.exception = new SDKException(exception);
+            throw this.exception;
+        }
+        return result;
+    }
+
+    /**
+     * POSTFILE
+     *
+     * @param url
+     * @param path
+     * @param name
+     * @param xml
+     * @return
+     */
+    public String POSTFILE(String url, String path, String name, String xml) {
+        if (this.debug) {
+            System.out.println("POST: " + url);
+            System.out.println("file: " + path);
+            System.out.println("XML: " + xml);
+        }
+        String result = "";
+        try {
+            File file = new File(path);
+            FileInputStream stream = new FileInputStream(file);
+            ByteArrayOutputStream output = new ByteArrayOutputStream();
+            int read = 0;
+            byte[] buffer = new byte[4096];
+            while ((read = stream.read(buffer)) != -1) {
+                output.write(buffer, 0, read);
+            }
+            byte[] byte_arr = output.toByteArray();
+            stream.close();
+            ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
+
+            MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
+
+            multipartEntity.addPart("file", fileBody);
+            multipartEntity.addPart("xml", new StringBody(xml));
+
+            HttpClient httpclient = new DefaultHttpClient();
+            HttpResponse response = null;
 
             HttpPost httppost = new HttpPost(url);
             httppost.setEntity(multipartEntity);
             response = httpclient.execute(httppost);
-			
-			HttpEntity entity = response.getEntity();
-			if (entity != null) {
-				result = EntityUtils.toString(entity, HTTP.UTF_8);
-			}
-
-			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-				this.exception = new SDKException(""
-				   + response.getStatusLine().getStatusCode()
-				   + " : " + result);
-	 			throw this.exception;
-			}
 
+            HttpEntity entity = response.getEntity();
+            if (entity != null) {
+                result = EntityUtils.toString(entity, HTTP.UTF_8);
+            }
+
+            if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
+                this.exception = new SDKException(""
+                        + response.getStatusLine().getStatusCode()
+                        + " : " + result);
+                throw this.exception;
+            }
+
+        } catch (Exception exception) {
+            this.exception = new SDKException(exception);
+            throw this.exception;
+        }
+        return result;
+    }
+
+    /**
+     * loadImage
+     *
+     * @param path
+     * @param reqWidth
+     * @param reqHeight
+     * @return
+     */
+    public PixelMap loadImage(String path, int reqWidth, int reqHeight) {
+        return null;
+    }
+
+    /**
+     * getVoice
+     *
+     * @param config
+     * @return
+     */
+    public VoiceConfig getVoice(InstanceConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-voice", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            VoiceConfig voice = new VoiceConfig();
+            voice.parseXML(root);
+            return voice;
         } catch (Exception exception) {
- 			this.exception = new SDKException(exception);
- 			throw this.exception;
- 		}
- 		return result;
-	}
-
-	public PixelMap loadImage(String path, int reqWidth, int reqHeight) {
-//	    BitmapFactory.Options options = new BitmapFactory.Options(); //=====================
-//	    options.inJustDecodeBounds = true;
-//	    BitmapFactory.decodeFile(path, options);
-//
-//        int height = options.outHeight;
-//        int width = options.outWidth;
-//        options.inPreferredConfig = Bitmap.Config.RGB_565;
-//        int inSampleSize = 1;
-//
-//        if (height > reqHeight) {
-//            inSampleSize = Math.round((float)height / (float)reqHeight);
-//        }
-//
-//        int expectedWidth = width / inSampleSize;
-//
-//        if (expectedWidth > reqWidth) {
-//            inSampleSize = Math.round((float)width / (float)reqWidth);
-//        }
-//
-//	    options.inSampleSize = inSampleSize;
-//	    options.inJustDecodeBounds = false;
-//
-//	    return BitmapFactory.decodeFile(path, options);
-		return null;
-	 }
-	
-	/**
-	 * Return the forum's bot configuration.
-	 */
-	public BotModeConfig getForumBotMode(ForumConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-forum-bot-mode", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			BotModeConfig botMode = new BotModeConfig();
-			botMode.parseXML(root);
-			return botMode;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Return the bot's voice configuration.
-	 */
-	public VoiceConfig getVoice(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-voice", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			VoiceConfig voice = new VoiceConfig();
-			voice.parseXML(root);
-			return voice;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Return the bot's default responses.
-	 */
-	public List<String> getDefaultResponses(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-default-responses", config.toXML());
-		List<String> defaultResponses = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return defaultResponses;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			defaultResponses.add(((Element)root.getChildNodes().item(index)).getChildNodes().item(0).getTextContent());
-		}
-		return defaultResponses;
-	}
-	
-	/**
-	 * Return the bot's greetings.
-	 */
-	public List<String> getGreetings(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-greetings", config.toXML());
-		List<String> greetings = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return greetings;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			greetings.add(((Element)root.getChildNodes().item(index)).getChildNodes().item(0).getTextContent());
-		}
-		return greetings;
-	}
-	
-	/**
-	 * Search the bot's responses.
-	 */
-	public List<ResponseConfig> getResponses(ResponseSearchConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-responses", config.toXML());
-		List<ResponseConfig> responses = new ArrayList<ResponseConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return responses;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			ResponseConfig response = new ResponseConfig();
-			response.parseXML((Element)root.getChildNodes().item(index));
-			responses.add(response);
-		}
-		return responses;
-	}
-	
-	/**
-	 * Search the bot's conversations.
-	 */
-	public List<ConversationConfig> getConversations(ResponseSearchConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-conversations", config.toXML());
-		List<ConversationConfig> conversations = new ArrayList<ConversationConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return conversations;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			ConversationConfig response = new ConversationConfig();
-			response.parseXML((Element)root.getChildNodes().item(index));
-			conversations.add(response);
-		}
-		return conversations;
-	}
-	
-	/**
-	 * Return the bot's learning configuration.
-	 */
-	public LearningConfig getLearning(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-learning", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			LearningConfig learning = new LearningConfig();
-			learning.parseXML(root);
-			return learning;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Return the list of content for the browse criteria.
-	 * The type defines the content type (one of Bot, Forum, Channel, Domain).
-	 */
-	public List<WebMediumConfig> browse(Ability ability,BrowseConfig config) {
-		config.addCredentials(this);
-		String type = "";
-		if (config.type.equals("Bot")) {
-			type = "/get-instances";
-		} else {
-			type = "/get-" + config.type.toLowerCase() + "s";
-		}
-		String xml = POSTUpdate(ability,this.url + type, config.toXML());
-		List<WebMediumConfig> instances = new ArrayList<WebMediumConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return instances;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			WebMediumConfig instance = null;
-			if (config.type.equals("Bot")) {
-				instance = new InstanceConfig();
-			} else if (config.type.equals("Forum")) {
-				instance = new ForumConfig();
-			} else if (config.type.equals("Channel")) {
-				instance = new ChannelConfig();
-			} else if (config.type.equals("Domain")) {
-				instance = new DomainConfig();
-			} else if (config.type.equals("Avatar")) {
-				instance = new AvatarConfig();
-			} else if (config.type.equals("Script")) {
-				instance = new ScriptConfig();
-			}else if (config.type.equals("Graphic")) {
-				instance = new GraphicConfig();
-			}
-			instance.parseXML((Element)root.getChildNodes().item(index));
-			instances.add(instance);
-		}
-		return instances;
-	}
-	
-	/**
-	 * Return the list of media for the avatar.
-	 */
-	public List<AvatarMedia> getAvatarMedia(AvatarConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-avatar-media", config.toXML());
-		List<AvatarMedia> instances = new ArrayList<AvatarMedia>();
-		Element root = parse(xml);
-		if (root == null) {
-			return instances;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			AvatarMedia instance = new AvatarMedia();
-			instance.parseXML((Element)root.getChildNodes().item(index));
-			instances.add(instance);
-		}
-		return instances;
-	}
-	
-	/**
-	 * Return the script source
-	 */
-	public ScriptSourceConfig getScriptSource(ScriptConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-script-source", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ScriptSourceConfig script = new ScriptSourceConfig();
-			script.parseXML(root);
-			return script;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create or update script - Save the script source
-	 */
-	public void saveScriptSource(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-script-source", config.toXML());
-	}
-	
-	/**
-	 * Return the source code for a single bot script
-	 */
-	public ScriptSourceConfig getBotScriptSource(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-bot-script-source", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ScriptSourceConfig botScript = new ScriptSourceConfig();
-			botScript.parseXML(root);
-			return botScript;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Return a list of the bots scripts
-	 */
-	public List<ScriptConfig> getBotScripts(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-bot-scripts", config.toXML());
-		List<ScriptConfig> botScripts = new ArrayList<ScriptConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return botScripts;
-		}
-		for (int i = 0; i < root.getChildNodes().getLength(); i++) {
-			ScriptConfig script = new ScriptConfig();
-			script.parseXML((Element)root.getChildNodes().item(i));
-			botScripts.add(script);
-		}
-		return botScripts;
-	}
-	/**
-	 * import a script to the bot
-	 */
-	
-	public void importBotScript(ScriptConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/import-bot-script", config.toXML());
-	}
-	
-	/**
-	 * import a chatlog/response list to the bot
-	 */
-	public void importBotLog(ScriptConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/import-bot-log", config.toXML());
-	}
-	
-	
-	/**
-	 * Save the bot script source
-	 */
-	public void saveBotScriptSource(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-bot-script-source", config.toXML());
-	}
-	
-	/**
-	 * Delete selected bot script
-	 */
-	public void deleteBotScript(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-bot-script", config.toXML());
-	}
-	
-	/**
-	 * Move up one bot script
-	 */
-	public void upBotScript(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/up-bot-script", config.toXML());
-	}
-	
-	/**
-	 * Move down one bot script
-	 */
-	public void downBotScript(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/down-bot-script", config.toXML());
-	}
-	
-	/**
-	 * Return the list of content types.
-	 */
-	public String[] getTypes() {
-		return types;
-	}
-	
-	/**
-	 * Return the channel types.
-	 */
-	public String[] getChannelTypes() {
-		return channelTypes;
-	}
-	
-	/**
-	 * Return the access mode types.
-	 */
-	public String[] getAccessModes() {
-		return accessModes;
-	}
-	
-	/**
-	 * Return the media access mode types.
-	 */
-	public String[] getMediaAccessModes() {
-		return mediaAccessModes;
-	}
-	
-	/**
-	 * Return the learning mode types.
-	 */
-	public String[] getLearningModes() {
-		return learningModes;
-	}
-	
-	/**
-	 * Return the correction mode types.
-	 */
-	public String[] getCorrectionModes() {
-		return correctionModes;
-	}
-	
-	/**
-	 * Return the bot mode types.
-	 */
-	public String[] getBotModes() {
-		return botModes;
-	}
-	
-	/**
-	 * Return the current connected user.
-	 */
-	public UserConfig getUser() {
-		return user;
-	}
-	
-	/**
-	 * Set the current connected user.
-	 * connect() should be used to validate and connect a user.
-	 */
-	public void setUser(UserConfig user) {
-		this.user = user;
-	}
-	
-	/**
-	 * Return the current domain.
-	 * A domain is an isolated content space.
-	 */
-	public DomainConfig getDomain() {
-		return domain;
-	}
-	
-	/**
-	 * Set the current domain.
-	 * A domain is an isolated content space.
-	 * connect() should be used to validate and connect a domain.
-	 */
-	public void setDomain(DomainConfig domain) {
-		this.domain = domain;
-	}
-	
-	/**
-	 * Return the current application credentials.
-	 */
-	public Credentials getCredentials() {
-		return credentials;
-	}
-	
-	/**
-	 * Set the application credentials.
-	 */
-	public void setCredentials(Credentials credentials) {
-		this.credentials = credentials;
-		this.url = credentials.url;
-	}
-	
-	/**
-	 * Return is debugging has been enabled.
-	 */
-	public boolean isDebug() {
-		return debug;
-	}
-	
-	/**
-	 * Enable debugging, debug messages will be logged to System.out.
-	 */
-	public void setDebug(boolean debug) {
-		this.debug = debug;
-	}
-	
-	/**
-	 * Return the last thrown exception.
-	 */
-	public SDKException getException() {
-		return exception;
-	}
-
-	protected void setException(SDKException exception) {
-		this.exception = exception;
-	}
-
-	public String GET(String url) {
-		if (this.debug) {
-			System.out.println("GET: " + url);
-		}
-		String xml = null;
-		try {
-			HttpClient httpClient = new DefaultHttpClient();
-			HttpContext localContext = new BasicHttpContext();
-			HttpGet httpGet = new HttpGet(url);
-			HttpResponse response = httpClient.execute(httpGet, localContext);
-			HttpEntity entity = response.getEntity();
-			xml = EntityUtils.toString(entity, HTTP.UTF_8);
-
-			if (response.getStatusLine().getStatusCode() != 200) {
-				this.exception = new SDKException(""
-				   + response.getStatusLine().getStatusCode()
-				   + " : " + xml);
-				return "";
-			}
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-			this.exception = new SDKException(exception);
-			throw this.exception;
-		}
-		return xml;
-	}
-
-	public String POST(String url, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		try {
-			HttpClient httpClient = new DefaultHttpClient();
-			HttpContext localContext = new BasicHttpContext();
-			HttpPost httpPost = new HttpPost(url);
-
-			StringEntity content = new StringEntity(xml, "utf-8");
-			content.setContentType("application/xml");
-			httpPost.setEntity(content);
-
-			HttpResponse response = httpClient.execute(httpPost, localContext);
-
-			HttpEntity entity = response.getEntity();
-			if (entity != null) {
-				result = EntityUtils.toString(entity, HTTP.UTF_8);
-			}
-			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-				this.exception = new SDKException(""
-				   + response.getStatusLine().getStatusCode()
-				   + " : " + result);
-				throw this.exception;
-			}
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-			this.exception = new SDKException(exception);
-			throw this.exception;
-		}
-		return result;
-	}
-
-	public String POSTUpdate(Ability ability,String url, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		Response response = null;
-		try {
-			ClearableCookieJar cookieJar = new PersistentCookieJar(new SetCookieCache(),
-					new SharedPrefsCookiePersistor(ability));
-			OkHttpClient okHttpClient = new OkHttpClient.Builder()
-					.cookieJar(cookieJar)
-					.build();
-			response = getResponse(okHttpClient, url,xml);
-
-			if ((response.code() != 200) && (response.code() != 204)) {
-				this.exception = new SDKException(response.code()+"");
-				throw this.exception;
-			}
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * getDefaultResponses
+     *
+     * @param config
+     * @return
+     */
+    public List<String> getDefaultResponses(InstanceConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-default-responses", config.toXML());
+        List<String> defaultResponses = new ArrayList<String>();
+        Element root = parse(xml);
+        if (root == null) {
+            return defaultResponses;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            defaultResponses.add(((Element) root.getChildNodes().item(index)).getChildNodes().item(0).getTextContent());
+        }
+        return defaultResponses;
+    }
+
+
+    /**
+     * getLearning
+     *
+     * @param config
+     * @return
+     */
+    public LearningConfig getLearning(InstanceConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-learning", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            LearningConfig learning = new LearningConfig();
+            learning.parseXML(root);
+            return learning;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * browse
+     *
+     * @param ability
+     * @param config
+     * @return
+     */
+    public List<WebMediumConfig> browse(Ability ability, BrowseConfig config) {
+        config.addCredentials(this);
+        String type = "";
+        if (config.type.equals("Bot")) {
+            type = "/get-instances";
+        } else {
+            type = "/get-" + config.type.toLowerCase() + "s";
+        }
+        String xml = POSTUpdate(ability, this.url + type, config.toXML());
+        List<WebMediumConfig> instances = new ArrayList<WebMediumConfig>();
+        Element root = parse(xml);
+        if (root == null) {
+            return instances;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            WebMediumConfig instance = null;
+            if (config.type.equals("Bot")) {
+                instance = new InstanceConfig();
+            } else if (config.type.equals("Forum")) {
+                instance = new ForumConfig();
+            } else if (config.type.equals("Channel")) {
+                instance = new ChannelConfig();
+            } else if (config.type.equals("Domain")) {
+                instance = new DomainConfig();
+            } else if (config.type.equals("Avatar")) {
+                instance = new AvatarConfig();
+            } else if (config.type.equals("Script")) {
+                instance = new ScriptConfig();
+            } else if (config.type.equals("Graphic")) {
+                instance = new GraphicConfig();
+            }
+            instance.parseXML((Element) root.getChildNodes().item(index));
+            instances.add(instance);
+        }
+        return instances;
+    }
+
+    /**
+     * getAvatarMedia
+     *
+     * @param config
+     * @return
+     */
+    public List<AvatarMedia> getAvatarMedia(AvatarConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-avatar-media", config.toXML());
+        List<AvatarMedia> instances = new ArrayList<AvatarMedia>();
+        Element root = parse(xml);
+        if (root == null) {
+            return instances;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            AvatarMedia instance = new AvatarMedia();
+            instance.parseXML((Element) root.getChildNodes().item(index));
+            instances.add(instance);
+        }
+        return instances;
+    }
+
+
+    /**
+     * saveScriptSource
+     *
+     * @param config
+     */
+    public void saveScriptSource(ScriptSourceConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/save-script-source", config.toXML());
+    }
+
+
+    /**
+     * getBotScripts
+     *
+     * @param config
+     * @return
+     */
+    public List<ScriptConfig> getBotScripts(InstanceConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-bot-scripts", config.toXML());
+        List<ScriptConfig> botScripts = new ArrayList<ScriptConfig>();
+        Element root = parse(xml);
+        if (root == null) {
+            return botScripts;
+        }
+        for (int i = 0; i < root.getChildNodes().getLength(); i++) {
+            ScriptConfig script = new ScriptConfig();
+            script.parseXML((Element) root.getChildNodes().item(i));
+            botScripts.add(script);
+        }
+        return botScripts;
+    }
+
+
+    /**
+     * downBotScript
+     *
+     * @param config
+     */
+    public void downBotScript(ScriptSourceConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/down-bot-script", config.toXML());
+    }
+
+    /**
+     * getTypes
+     *
+     * @return
+     */
+    public String[] getTypes() {
+        return types;
+    }
+
+    /**
+     * getChannelTypes
+     *
+     * @return
+     */
+    public String[] getChannelTypes() {
+        return channelTypes;
+    }
+
+    /**
+     * getAccessModes
+     *
+     * @return
+     */
+    public String[] getAccessModes() {
+        return accessModes;
+    }
+
+    /**
+     * getMediaAccessModes
+     *
+     * @return
+     */
+    public String[] getMediaAccessModes() {
+        return mediaAccessModes;
+    }
+
+    /**
+     * getUser
+     *
+     * @return
+     */
+    public UserConfig getUser() {
+        return user;
+    }
+
+    /**
+     * setUser
+     *
+     * @param user
+     */
+    public void setUser(UserConfig user) {
+        this.user = user;
+    }
+
+    /**
+     * getDomain
+     *
+     * @return
+     */
+    public DomainConfig getDomain() {
+        return domain;
+    }
+
+    /**
+     * setDomain
+     *
+     * @param domain
+     */
+    public void setDomain(DomainConfig domain) {
+        this.domain = domain;
+    }
+
+    /**
+     * getCredentials
+     *
+     * @return
+     */
+    public Credentials getCredentials() {
+        return credentials;
+    }
+
+    /**
+     * setCredentials
+     *
+     * @param credentials
+     */
+    public void setCredentials(Credentials credentials) {
+        this.credentials = credentials;
+        this.url = credentials.url;
+    }
+
+    /**
+     * setDebug
+     *
+     * @param debug
+     */
+    public void setDebug(boolean debug) {
+        this.debug = debug;
+    }
+
+    /**
+     * getException
+     *
+     * @return
+     */
+    public SDKException getException() {
+        return exception;
+    }
+
+    /**
+     * setException
+     *
+     * @param exception
+     */
+    protected void setException(SDKException exception) {
+        this.exception = exception;
+    }
+
+    /**
+     * GET
+     *
+     * @param url
+     * @return
+     */
+    public String GET(String url) {
+        if (this.debug) {
+            System.out.println("GET: " + url);
+        }
+        String xml = null;
+        try {
+            HttpClient httpClient = new DefaultHttpClient();
+            HttpContext localContext = new BasicHttpContext();
+            HttpGet httpGet = new HttpGet(url);
+            HttpResponse response = httpClient.execute(httpGet, localContext);
+            HttpEntity entity = response.getEntity();
+            xml = EntityUtils.toString(entity, HTTP.UTF_8);
+
+            if (response.getStatusLine().getStatusCode() != 200) {
+                this.exception = new SDKException(""
+                        + response.getStatusLine().getStatusCode()
+                        + " : " + xml);
+                return "";
+            }
+        } catch (Exception exception) {
+            if (this.debug) {
+                exception.printStackTrace();
+            }
+            this.exception = new SDKException(exception);
+            throw this.exception;
+        }
+        return xml;
+    }
+
+    /**
+     * POST
+     *
+     * @param url
+     * @param xml
+     * @return
+     */
+    public String POST(String url, String xml) {
+        if (this.debug) {
+            System.out.println("POST: " + url);
+            System.out.println("XML: " + xml);
+        }
+        String result = "";
+        try {
+            HttpClient httpClient = new DefaultHttpClient();
+            HttpContext localContext = new BasicHttpContext();
+            HttpPost httpPost = new HttpPost(url);
+
+            StringEntity content = new StringEntity(xml, "utf-8");
+            content.setContentType("application/xml");
+            httpPost.setEntity(content);
+
+            HttpResponse response = httpClient.execute(httpPost, localContext);
+
+            HttpEntity entity = response.getEntity();
+            if (entity != null) {
+                result = EntityUtils.toString(entity, HTTP.UTF_8);
+            }
+            if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
+                this.exception = new SDKException(""
+                        + response.getStatusLine().getStatusCode()
+                        + " : " + result);
+                throw this.exception;
+            }
+        } catch (Exception exception) {
+            if (this.debug) {
+                exception.printStackTrace();
+            }
+            this.exception = new SDKException(exception);
+            throw this.exception;
+        }
+        return result;
+    }
+
+    /**
+     * POSTUpdate
+     *
+     * @param ability
+     * @param url
+     * @param xml
+     * @return
+     */
+    public String POSTUpdate(Ability ability, String url, String xml) {
+        if (this.debug) {
+            System.out.println("POST: " + url);
+            System.out.println("XML: " + xml);
+        }
+        String result = "";
+        Response response = null;
+        try {
+            ClearableCookieJar cookieJar = new PersistentCookieJar(new SetCookieCache(),
+                    new SharedPrefsCookiePersistor(ability));
+            OkHttpClient okHttpClient = new OkHttpClient.Builder()
+                    .cookieJar(cookieJar)
+                    .build();
+            response = getResponse(okHttpClient, url, xml);
+
+            if ((response.code() != 200) && (response.code() != 204)) {
+                this.exception = new SDKException(response.code() + "");
+                throw this.exception;
+            }
+        } catch (Exception exception) {
+            if (this.debug) {
+                exception.printStackTrace();
+            }
 //			this.exception = new SDKException(exception);
 //			throw this.exception;
-		}
-		return response.body().toString();
-	}
-
-	/**
-	 * This method is used to get cookies from response
-	 *
-	 * @param client OkHttpClient to get cookies from response
-	 * @param url Http URL
-	 */
-	public Response getResponse(OkHttpClient client, String url, String xml) {
-		// code request code here
-		MediaType mediaType = MediaType.parse("text/x-markdown; charset=utf-8");
-		String requestBody = xml;
-		Request request = new Request.Builder()
-				.url(url)
-				.post(RequestBody.create(mediaType, requestBody))
-				.build();
-		Call call = client.newCall(request);
-		try {
-			Response response = call.execute();
-			return response;
-		} catch (IOException e) {
-			e.printStackTrace();
-		}
-//		call.enqueue(new Callback() {
-//			@Override
-//			public void onFailure(Call call, IOException exception) {
-//			}
-//
-//			@Override
-//			public void onResponse(Call call, Response response) {
-//				if (response != null && response.body() != null) {
-//					List<String> cookieList = response.headers("Set-Cookie");
-//					StringBuilder stringBuilder = new StringBuilder();
-//					if (cookieList.size() > 0) {
-//						for (String cookie : cookieList) {
-//							stringBuilder.append(cookie).append(",");
-//						}
-//					}
-//					content[0] = response.body().toString();
-//				}
-//			}
-//		});
-		return null;
-	}
-	
-	public Element parse(String xml) {
-		if (this.debug) {
-			System.out.println(xml);
-		}
-		Document dom = null;
-		DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance();
-		try {
-			DocumentBuilder builder = factory.newDocumentBuilder();
-			InputSource source = new InputSource();
-			source.setCharacterStream(new StringReader(xml));
-			dom = builder.parse(source);
-			return dom.getDocumentElement();
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-//			this.exception = new SDKException(exception.getMessage(), exception);
-//			throw this.exception;
-			return null;
-		}
-	}
+        }
+        return response.body().toString();
+    }
+
+    /**
+     * This method is used to get cookies from response
+     *
+     * @param client OkHttpClient to get cookies from response
+     * @param url    Http URL
+     */
+    public Response getResponse(OkHttpClient client, String url, String xml) {
+        // code request code here
+        MediaType mediaType = MediaType.parse("text/x-markdown; charset=utf-8");
+        String requestBody = xml;
+        Request request = new Request.Builder()
+                .url(url)
+                .post(RequestBody.create(mediaType, requestBody))
+                .build();
+        Call call = client.newCall(request);
+        try {
+            Response response = call.execute();
+            return response;
+        } catch (IOException e) {
+            e.printStackTrace();
+        }
+        return null;
+    }
+
+    /**
+     * parse
+     *
+     * @param xml
+     * @return
+     */
+    public Element parse(String xml) {
+        if (this.debug) {
+            System.out.println(xml);
+        }
+        return (Element) new ShapeElement();
+    }
 
 }
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/BaseAbility.java
similarity index 85%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/BaseAbility.java
index 974e7041f5a8b8f9d1120d99d79dfbaa4907e0b4..c659c6a66288d1f3dd8b6623b662c74d8d26148d 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/BaseAbility.java
@@ -1,4 +1,4 @@
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
index fb325e52b0c6a6ae7a3240f806bb52ed2b3d1067..a113dbe2de311c50161407295b3e6911e3a34f63 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
@@ -16,9 +16,9 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Text;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
similarity index 86%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
index f4747945713e38ac9c3c0959a28c4f5c90e5bbcc..94c3ae08cb982e617360bf18c89f16dd70405113 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
@@ -16,28 +16,8 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpGetImageAction;
-import org.botlibre.sdk.activityy.actions.HttpGetVideoAction;
-import org.botlibre.sdk.activityy.adapter.EmoteAdapter;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ChatConfig;
-import org.botlibre.sdk.config.ChatResponse;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.VoiceConfig;
-import org.botlibre.sdk.provider.ChatListProvicer;
-import org.botlibre.sdk.util.FileUtils;
-import org.botlibre.sdk.util.LogUtils;
-import org.botlibre.sdk.util.PreferencesUtils;
-import org.botlibre.sdk.util.ResUtils;
-import org.botlibre.sdk.util.ShapeUtils;
-import org.botlibre.sdk.util.TextStream;
-import org.botlibre.sdk.util.ToastUtils;
-import org.botlibre.sdk.util.Utils;
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
@@ -78,15 +58,30 @@ import ohos.media.audio.AudioCapturerInfo;
 import ohos.media.audio.AudioManager;
 import ohos.media.audio.AudioRemoteException;
 import ohos.media.audio.AudioStreamInfo;
-import ohos.media.common.Source;
 import ohos.media.image.PixelMap;
 import ohos.media.player.Player;
 import ohos.multimodalinput.event.TouchEvent;
 import ohos.security.SystemPermission;
 import ohos.utils.PacMap;
-import ohos.utils.net.Uri;
 import ohos.utils.zson.ZSONArray;
 import ohos.utils.zson.ZSONObject;
+import org.botlibre.sdk.MainAbility;
+import org.botlibre.sdk.ResourceTable;
+import org.botlibre.sdk.ability.adapter.EmoteAdapter;
+import org.botlibre.sdk.config.AvatarConfig;
+import org.botlibre.sdk.config.BrowseConfig;
+import org.botlibre.sdk.config.ChatConfig;
+import org.botlibre.sdk.config.ChatResponse;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.VoiceConfig;
+import org.botlibre.sdk.provider.ChatListProvicer;
+import org.botlibre.sdk.util.FileUtils;
+import org.botlibre.sdk.util.LogUtils;
+import org.botlibre.sdk.util.PreferencesUtils;
+import org.botlibre.sdk.util.ResUtils;
+import org.botlibre.sdk.util.ShapeUtils;
+import org.botlibre.sdk.util.TextStream;
+import org.botlibre.sdk.util.ToastUtils;
 
 import java.io.IOException;
 import java.io.StringWriter;
@@ -1370,8 +1365,6 @@ public class ChatAbility extends LibreAbility {
     }
 
     public void resetAvatar(AvatarConfig config) {
-        HttpGetImageAction.fetchImage(this, config.avatar, this.bigImage);
-        HttpGetImageAction.fetchImage(this, config.avatar, (Image) findComponentById(ResourceTable.Id_responseImageView));
     }
 
     public void micConfiguration() {
@@ -1497,8 +1490,6 @@ public class ChatAbility extends LibreAbility {
                 LogUtils.sop("Error: " + ignore.getMessage());
             }
         }
-        //needs when calling "sleep" or the its not going to let the mic off
-        //also to stop the mic until the bot finish the sentence
         try {
             stopListening();
             this.response = response;
@@ -1529,21 +1520,13 @@ public class ChatAbility extends LibreAbility {
 
             final String text = response.message;
             if (text == null) {
-                //listContainer.invalidateViews();
-//                if (listContainer.getChildCount() > 2) {
-//                    listContainer.setSelection(list.getCount() - 2);
-//                }
+
                 beginListening();
                 return;
             }
             messages.add(response);
             chatProvider.notifyDataChanged();
-//            listContainer.invalidateViews();
-//            if (listContainer.getCount() > 2) {
-//                listContainer.setSelection(list.getCount() - 2);
-//            }
-
-            String html = Utils.linkHTML(text);
+            String html ="";
             if (stateLayouts == 3 || stateLayouts == 4) {
                 ToastUtils.show(ability, html);
             }
@@ -1554,78 +1537,11 @@ public class ChatAbility extends LibreAbility {
             boolean talk = (text.trim().length() > 0) && (MainAbility.deviceVoice || (this.response.speech != null && this.response.speech.length() > 0));
             if (MainAbility.sound && talk) {
                 if (!MainAbility.disableVideo && !videoError && this.response.isVideo() && this.response.isVideoTalk()) {
-
-//                    videoView.setOnPreparedListener(new OnPreparedListener() {
-//                        @Override
-//                        public void onPrepared(MediaPlayer mp) {
-//                            try {
-//                                mp.setLooping(true);
-//                                if (!MainAbility.deviceVoice) {
-//                                    // Voice audio
-//                                    if (MainAbility.online) {
-//                                        speechPlayer = playAudio(response.speech, false, false, false);
-//                                        speechPlayer.setOnCompletionListener(new OnCompletionListener() {
-//                                            @Override
-//                                            public void onCompletion(MediaPlayer mp) {
-//                                                mp.release();
-//                                                videoView.post(new Runnable() {
-//                                                    public void run() {
-//                                                        cycleVideo(response);
-//                                                    }
-//                                                });
-//                                                runOnUiThread(new Runnable() {
-//                                                    public void run() {
-//                                                        if (!music) {
-//                                                            beginListening();
-//                                                        }
-//                                                    }
-//                                                });
-//                                            }
-//                                        });
-//
-//                                        speechPlayer.play();
-//                                    }
-//                                } else {
-//                                    HashMap<String, String> params = new HashMap<String, String>();
-//                                    params.put(TextToSpeech.Engine.KEY_PARAM_UTTERANCE_ID, "id");
-//
-//                                    tts.speakText(Utils.stripTags(text), TextToSpeech.QUEUE_FLUSH, params);
-//                                }
-//                            } catch (Exception exception) {
-//                                LogUtils.sop(exception.getMessage());
-//                            }
-//                        }
-//                    });
-                    playVideo(this.response.avatarTalk, false);
                 } else if (talk) {
-//                    if (!MainAbility.deviceVoice) {
-//                        // Voice audio
-//                        if (MainAbility.online) {
-//                            playAudio(this.response.speech, false, false, true);
-//                        }
-//                    } else {
-//                        HashMap<String, String> params = new HashMap<String, String>();
-//                        params.put(TextToSpeech.Engine.KEY_PARAM_UTTERANCE_ID, "id");
-//
-//                        this.tts.speakText(Utils.stripTags(text), TextToSpeech.QUEUE_FLUSH, params);
-//                    }
+
                 }
             } else if (talk && (!MainAbility.disableVideo && !videoError && this.response.isVideo() && this.response.avatarTalk != null)) {
-//                videoView.setOnPreparedListener(new OnPreparedListener() {
-//                    @Override
-//                    public void onPrepared(MediaPlayer mp) {
-//                        mp.setLooping(false);
-//                    }
-//                });
-//                videoView.setOnCompletionListener(new OnCompletionListener() {
-//                    @Override
-//                    public void onCompletion(MediaPlayer mp) {
-//                        videoView.setOnCompletionListener(null);
-//                        cycleVideo(response);
-//                    }
-//                });
-                playVideo(this.response.avatarTalk, false);
-                //handler.sendEvent(BEGIN_LISTENING);
+
 
             } else {
                 //handler.sendEvent(BEGIN_LISTENING);
@@ -1649,152 +1565,8 @@ public class ChatAbility extends LibreAbility {
     }
 
 
-    public void playVideo(String video, boolean loop) {
-//        if (loop) {
-//            videoView.setOnPreparedListener(new OnPreparedListener() {
-//                @Override
-//                public void onPrepared(MediaPlayer mp) {
-//                    mp.setLooping(true);
-//                }
-//            });
-//        }
-//        try {
-//            Uri videoUri = HttpGetVideoAction.fetchVideo(this, video);
-//            if (videoUri == null) {
-//                if (MainAbility.online) {
-//                    videoUri = Uri.parse(MainAbility.connection.fetchImage(video).toURI().toString());
-//                }
-//            }
-//            videoView.setVideoURI(videoUri);
-//            videoView.start();
-//        } catch (Exception exception) {
-//            Log.wtf(exception.toString(), exception);
-//        }
-    }
 
-    public void cycleVideo(final ChatResponse response) {
-//        if ((response.avatar2 == null || response.avatar3 == null || response.avatar4 == null || response.avatar5 == null)
-//                || (response.avatar2.isEmpty() || response.avatar3.isEmpty() || response.avatar4.isEmpty() || response.avatar5.isEmpty())
-//                || (response.avatar.equals(response.avatar2) && response.avatar2.equals(response.avatar3)
-//                && response.avatar3.equals(response.avatar4) && response.avatar4.equals(response.avatar5))) {
-//            playVideo(response.avatar, true);
-//            return;
-//        }
-//        videoView.setOnPreparedListener(new OnPreparedListener() {
-//            @Override
-//            public void onPrepared(MediaPlayer mp) {
-//                mp.setLooping(false);
-//            }
-//        });
-//        videoView.setOnCompletionListener(new OnCompletionListener() {
-//            @Override
-//            public void onCompletion(MediaPlayer mp) {
-//                cycleVideo(response);
-//            }
-//        });
-//        int value = random.nextInt(5);
-//        String avatar = response.avatar;
-//        switch (value) {
-//            case 1:
-//                avatar = response.avatar2;
-//                break;
-//            case 2:
-//                avatar = response.avatar3;
-//                break;
-//            case 3:
-//                avatar = response.avatar5;
-//                break;
-//            case 14:
-//                avatar = response.avatar4;
-//                break;
-//        }
-//
-//        try {
-//            Uri videoUri = HttpGetVideoAction.fetchVideo(this, avatar);
-//            if (videoUri == null) {
-//                if (MainAbility.online) {
-//                    videoUri = Uri.parse(MainAbility.connection.fetchImage(avatar).toURI().toString());
-//                }
-//            }
-//            videoView.setVideoURI(videoUri);
-//            videoView.start();
-//        } catch (Exception exception) {
-//            LogUtils.sop(exception.toString());
-//        }
-    }
-
-    public Player playAudio(String audio, boolean loop, boolean cache, boolean start) {
-        try {
-            Uri audioUri = null;
-            if (cache) {
-                audioUri = HttpGetVideoAction.fetchVideo(this, audio);
-            }
-            if (audioUri == null) {
-                audioUri = Uri.parse(MainAbility.connection.fetchImage(audio).toURI().toString());
-            }
-            final Player audioPlayer = new Player(ability);
-            audioPlayer.setSource(new Source(String.valueOf(audioUri)));
-            audioPlayer.setPlayerCallback(new Player.IPlayerCallback() {
-                @Override
-                public void onPrepared() {
-
-                }
-
-                @Override
-                public void onMessage(int i, int i1) {
-
-                }
-
-                @Override
-                public void onError(int errorType, int errorCode) {
-                    LogUtils.sop("errorCode" + errorCode);
-                    audioPlayer.stop();
-                    audioPlayer.release();
-                }
 
-                @Override
-                public void onResolutionChanged(int i, int i1) {
-
-                }
-
-                @Override
-                public void onPlayBackComplete() {
-                    audioPlayer.release();
-                    //handler.sendEvent(BEGIN_LISTENING);
-
-                }
-
-                @Override
-                public void onRewindToComplete() {
-
-                }
-
-                @Override
-                public void onBufferingChange(int i) {
-
-                }
-
-                @Override
-                public void onNewTimedMetaData(Player.MediaTimedMetaData mediaTimedMetaData) {
-
-                }
-
-                @Override
-                public void onMediaTimeIncontinuity(Player.MediaTimeInfo mediaTimeInfo) {
-
-                }
-            });
-            audioPlayer.prepare();
-            audioPlayer.enableSingleLooping(loop);
-            if (start) {
-                audioPlayer.play();
-            }
-            return audioPlayer;
-        } catch (Exception exception) {
-            LogUtils.sop(exception.toString());
-            return null;
-        }
-    }
 
     public ChatResponse getResponse() {
         return response;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility2.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility2.java
similarity index 88%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility2.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility2.java
index daf3b452709c6af4f4f58230f7de33ee42f6b5fb..2424bd3a447a0689e380236d2031810655964ef0 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility2.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility2.java
@@ -16,30 +16,8 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpGetImageAction;
-import org.botlibre.sdk.activityy.actions.HttpGetVideoAction;
-import org.botlibre.sdk.activityy.adapter.CommandAdapter;
-import org.botlibre.sdk.activityy.adapter.EmoteAdapter;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ChatConfig;
-import org.botlibre.sdk.config.ChatResponse;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.VoiceConfig;
-import org.botlibre.sdk.provider.ChatListProvicer;
-import org.botlibre.sdk.util.ApplicationJumpUtil;
-import org.botlibre.sdk.util.LogUtils;
-import org.botlibre.sdk.util.PreferencesUtils;
-import org.botlibre.sdk.util.ResUtils;
-import org.botlibre.sdk.util.ShapeUtils;
-import org.botlibre.sdk.util.StringUtils;
-import org.botlibre.sdk.util.TextStream;
-import org.botlibre.sdk.util.ToastUtils;
-import org.botlibre.sdk.util.Utils;
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
@@ -78,16 +56,33 @@ import ohos.media.audio.AudioCapturerInfo;
 import ohos.media.audio.AudioManager;
 import ohos.media.audio.AudioRemoteException;
 import ohos.media.audio.AudioStreamInfo;
-import ohos.media.common.Source;
 import ohos.media.image.PixelMap;
 import ohos.media.player.Player;
 import ohos.multimodalinput.event.TouchEvent;
 import ohos.security.SystemPermission;
 import ohos.utils.IntentConstants;
 import ohos.utils.PacMap;
-import ohos.utils.net.Uri;
 import ohos.utils.zson.ZSONArray;
 import ohos.utils.zson.ZSONObject;
+import org.botlibre.sdk.MainAbility;
+import org.botlibre.sdk.ResourceTable;
+import org.botlibre.sdk.ability.adapter.CommandAdapter;
+import org.botlibre.sdk.ability.adapter.EmoteAdapter;
+import org.botlibre.sdk.config.AvatarConfig;
+import org.botlibre.sdk.config.BrowseConfig;
+import org.botlibre.sdk.config.ChatConfig;
+import org.botlibre.sdk.config.ChatResponse;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.VoiceConfig;
+import org.botlibre.sdk.provider.ChatListProvicer;
+import org.botlibre.sdk.util.ApplicationJumpUtil;
+import org.botlibre.sdk.util.LogUtils;
+import org.botlibre.sdk.util.PreferencesUtils;
+import org.botlibre.sdk.util.ResUtils;
+import org.botlibre.sdk.util.ShapeUtils;
+import org.botlibre.sdk.util.StringUtils;
+import org.botlibre.sdk.util.TextStream;
+import org.botlibre.sdk.util.ToastUtils;
 
 import java.io.StringWriter;
 import java.util.ArrayList;
@@ -437,49 +432,6 @@ public class ChatAbility2 extends LibreAbility {
                 //ApplicationJumpUtil.startAppFromPackageName(this,"com.example.recyclerviewswipedismiss"); // 通过包名调用应用
                 ApplicationJumpUtil.startAppFromPackageName(this,"com.example.summaryjs"); // 通过包名调用应用
                 break;
-            case "instagram":
-            case "snapchat":
-            case "youtube":
-            case "facebook":
-            case "messenger":
-            case "whatsapp":
-            case "chrome":
-            case "opera":
-            case "drive":
-            case "outlook":
-            case "yahoo":
-            case "gmail":
-            case "inbox":
-            case "shopify":
-            case "flashlight":
-            case "uber":
-            case "uber eats":
-            case "ubereats":
-            case "pinterest":
-            case "etsy":
-            case "shazam":
-            case "flipp":
-            case "urban spoon":
-            case "urbanspoon":
-            case "yelp":
-            case "trip advisor":
-            case "tripadvisor":
-            case "zomato":
-            case "amazon":
-            case "kindle":
-            case "paypal":
-            case "pay pal":
-            case "audible":
-            case "aliexpress":
-            case "ali express":
-            case "groupon":
-            case "group on":
-            case "acrobat":
-            case "photoshop":
-            case "lightroom":
-            case "candy crush":
-                reply = "Opening " + StringUtils.toUpperFirstCode(msg);
-                break;
             default:
                 reply = msg;
                 break;
@@ -1751,8 +1703,6 @@ public class ChatAbility2 extends LibreAbility {
     }
 
     public void resetAvatar(AvatarConfig config) {
-        HttpGetImageAction.fetchImage(this, config.avatar, this.bigImage);
-        HttpGetImageAction.fetchImage(this, config.avatar, (Image) findComponentById(ResourceTable.Id_responseImageView));
     }
 
     public void micConfiguration() {
@@ -1924,7 +1874,7 @@ public class ChatAbility2 extends LibreAbility {
 //                listContainer.setSelection(list.getCount() - 2);
 //            }
 
-            String html = Utils.linkHTML(text);
+            String html = "";//Utils.linkHTML(text)
             if (stateLayouts == 3 || stateLayouts == 4) {
                 ToastUtils.show(ability, html);
             }
@@ -1935,81 +1885,11 @@ public class ChatAbility2 extends LibreAbility {
             boolean talk = (text.trim().length() > 0) && (MainAbility.deviceVoice || (this.response.speech != null && this.response.speech.length() > 0));
             if (MainAbility.sound && talk) {
                 if (!MainAbility.disableVideo && !videoError && this.response.isVideo() && this.response.isVideoTalk()) {
-
-//                    videoView.setOnPreparedListener(new OnPreparedListener() {
-//                        @Override
-//                        public void onPrepared(MediaPlayer mp) {
-//                            try {
-//                                mp.setLooping(true);
-//                                if (!MainAbility.deviceVoice) {
-//                                    // Voice audio
-//                                    if (MainAbility.online) {
-//                                        speechPlayer = playAudio(response.speech, false, false, false);
-//                                        speechPlayer.setOnCompletionListener(new OnCompletionListener() {
-//                                            @Override
-//                                            public void onCompletion(MediaPlayer mp) {
-//                                                mp.release();
-//                                                videoView.post(new Runnable() {
-//                                                    public void run() {
-//                                                        cycleVideo(response);
-//                                                    }
-//                                                });
-//                                                runOnUiThread(new Runnable() {
-//                                                    public void run() {
-//                                                        if (!music) {
-//                                                            beginListening();
-//                                                        }
-//                                                    }
-//                                                });
-//                                            }
-//                                        });
-//
-//                                        speechPlayer.play();
-//                                    }
-//                                } else {
-//                                    HashMap<String, String> params = new HashMap<String, String>();
-//                                    params.put(TextToSpeech.Engine.KEY_PARAM_UTTERANCE_ID, "id");
-//
-//                                    tts.speakText(Utils.stripTags(text), TextToSpeech.QUEUE_FLUSH, params);
-//                                }
-//                            } catch (Exception exception) {
-//                                LogUtils.sop(exception.getMessage());
-//                            }
-//                        }
-//                    });
-                    playVideo(this.response.avatarTalk, false);
                 } else if (talk) {
-//                    if (!MainAbility.deviceVoice) {
-//                        // Voice audio
-//                        if (MainAbility.online) {
-//                            playAudio(this.response.speech, false, false, true);
-//                        }
-//                    } else {
-//                        HashMap<String, String> params = new HashMap<String, String>();
-//                        params.put(TextToSpeech.Engine.KEY_PARAM_UTTERANCE_ID, "id");
-//
-//                        this.tts.speakText(Utils.stripTags(text), TextToSpeech.QUEUE_FLUSH, params);
-//                    }
                 }
             } else if (talk && (!MainAbility.disableVideo && !videoError && this.response.isVideo() && this.response.avatarTalk != null)) {
-//                videoView.setOnPreparedListener(new OnPreparedListener() {
-//                    @Override
-//                    public void onPrepared(MediaPlayer mp) {
-//                        mp.setLooping(false);
-//                    }
-//                });
-//                videoView.setOnCompletionListener(new OnCompletionListener() {
-//                    @Override
-//                    public void onCompletion(MediaPlayer mp) {
-//                        videoView.setOnCompletionListener(null);
-//                        cycleVideo(response);
-//                    }
-//                });
-                playVideo(this.response.avatarTalk, false);
-                //handler.sendEvent(BEGIN_LISTENING);
 
             } else {
-                //handler.sendEvent(BEGIN_LISTENING);
             }
         } catch (Exception exception) {
             LogUtils.sop(exception.getMessage());
@@ -2029,154 +1909,6 @@ public class ChatAbility2 extends LibreAbility {
         super.onInactive();
     }
 
-
-    public void playVideo(String video, boolean loop) {
-//        if (loop) {
-//            videoView.setOnPreparedListener(new OnPreparedListener() {
-//                @Override
-//                public void onPrepared(MediaPlayer mp) {
-//                    mp.setLooping(true);
-//                }
-//            });
-//        }
-//        try {
-//            Uri videoUri = HttpGetVideoAction.fetchVideo(this, video);
-//            if (videoUri == null) {
-//                if (MainAbility.online) {
-//                    videoUri = Uri.parse(MainAbility.connection.fetchImage(video).toURI().toString());
-//                }
-//            }
-//            videoView.setVideoURI(videoUri);
-//            videoView.start();
-//        } catch (Exception exception) {
-//            Log.wtf(exception.toString(), exception);
-//        }
-    }
-
-    public void cycleVideo(final ChatResponse response) {
-//        if ((response.avatar2 == null || response.avatar3 == null || response.avatar4 == null || response.avatar5 == null)
-//                || (response.avatar2.isEmpty() || response.avatar3.isEmpty() || response.avatar4.isEmpty() || response.avatar5.isEmpty())
-//                || (response.avatar.equals(response.avatar2) && response.avatar2.equals(response.avatar3)
-//                && response.avatar3.equals(response.avatar4) && response.avatar4.equals(response.avatar5))) {
-//            playVideo(response.avatar, true);
-//            return;
-//        }
-//        videoView.setOnPreparedListener(new OnPreparedListener() {
-//            @Override
-//            public void onPrepared(MediaPlayer mp) {
-//                mp.setLooping(false);
-//            }
-//        });
-//        videoView.setOnCompletionListener(new OnCompletionListener() {
-//            @Override
-//            public void onCompletion(MediaPlayer mp) {
-//                cycleVideo(response);
-//            }
-//        });
-//        int value = random.nextInt(5);
-//        String avatar = response.avatar;
-//        switch (value) {
-//            case 1:
-//                avatar = response.avatar2;
-//                break;
-//            case 2:
-//                avatar = response.avatar3;
-//                break;
-//            case 3:
-//                avatar = response.avatar5;
-//                break;
-//            case 14:
-//                avatar = response.avatar4;
-//                break;
-//        }
-//
-//        try {
-//            Uri videoUri = HttpGetVideoAction.fetchVideo(this, avatar);
-//            if (videoUri == null) {
-//                if (MainAbility.online) {
-//                    videoUri = Uri.parse(MainAbility.connection.fetchImage(avatar).toURI().toString());
-//                }
-//            }
-//            videoView.setVideoURI(videoUri);
-//            videoView.start();
-//        } catch (Exception exception) {
-//            LogUtils.sop(exception.toString());
-//        }
-    }
-
-    public Player playAudio(String audio, boolean loop, boolean cache, boolean start) {
-        try {
-            Uri audioUri = null;
-            if (cache) {
-                audioUri = HttpGetVideoAction.fetchVideo(this, audio);
-            }
-            if (audioUri == null) {
-                audioUri = Uri.parse(MainAbility.connection.fetchImage(audio).toURI().toString());
-            }
-            final Player audioPlayer = new Player(ability);
-            audioPlayer.setSource(new Source(String.valueOf(audioUri)));
-            audioPlayer.setPlayerCallback(new Player.IPlayerCallback() {
-                @Override
-                public void onPrepared() {
-
-                }
-
-                @Override
-                public void onMessage(int i, int i1) {
-
-                }
-
-                @Override
-                public void onError(int errorType, int errorCode) {
-                    LogUtils.sop("errorCode" + errorCode);
-                    audioPlayer.stop();
-                    audioPlayer.release();
-                }
-
-                @Override
-                public void onResolutionChanged(int i, int i1) {
-
-                }
-
-                @Override
-                public void onPlayBackComplete() {
-                    audioPlayer.release();
-                    //handler.sendEvent(BEGIN_LISTENING);
-
-                }
-
-                @Override
-                public void onRewindToComplete() {
-
-                }
-
-                @Override
-                public void onBufferingChange(int i) {
-
-                }
-
-                @Override
-                public void onNewTimedMetaData(Player.MediaTimedMetaData mediaTimedMetaData) {
-
-                }
-
-                @Override
-                public void onMediaTimeIncontinuity(Player.MediaTimeInfo mediaTimeInfo) {
-
-                }
-            });
-            audioPlayer.prepare();
-            audioPlayer.enableSingleLooping(loop);
-            if (start) {
-                audioPlayer.play();
-            }
-            return audioPlayer;
-        } catch (Exception exception) {
-            LogUtils.sop(exception.toString());
-            return null;
-        }
-    }
-
     public ChatResponse getResponse() {
         return response;
     }
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
index 0fbafdfde93430b234ed7a2b82d0ce7d4ae7cd58..a27cd18b1299f79d087d4d640da74ea508ca3cc2 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
@@ -16,10 +16,10 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpCreateUserAction;
+import org.botlibre.sdk.ability.actions.HttpCreateUserAction;
 import org.botlibre.sdk.config.UserConfig;
 import org.botlibre.sdk.util.ResUtil;
 import ohos.aafwk.content.Intent;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
index 867233c8dcd3a0c90f17c57333ca6f8f7c46862f..6482acb8bedd2ecf15941cb13b60b6e39e441ea2 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 /**
  * A convenience enum of different emotional states.
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
similarity index 95%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
index 4d34816546b125835bef140d490e966018b9d0c5..3fe761758467de39c6a7641b848c68d56e6431c3 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
@@ -16,13 +16,13 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpFetchAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.actions.HttpResultAction;
+import org.botlibre.sdk.ability.actions.HttpFetchAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.actions.HttpResultAction;
 import org.botlibre.sdk.config.BrowseConfig;
 import org.botlibre.sdk.config.ChannelConfig;
 import org.botlibre.sdk.config.ForumConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
similarity index 63%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
index d9f23297624c7aa0919fae53bc5e722999b24c6b..772f19f30b127edc6d52ddded8306a817a90ab11 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
@@ -16,31 +16,24 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.util.AsyncTask;
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
 import ohos.aafwk.content.Operation;
+import ohos.eventhandler.EventHandler;
+import ohos.eventhandler.EventRunner;
 
-public abstract class HttpAction extends AsyncTask<Void, Void, String>  {
-    protected Ability ability;
-    protected Exception exception;
-
-    public HttpAction(Ability ability) {
-        this.ability = ability;
-    }
-
-    public Exception getException() {
-        return exception;
-    }
-
-    public void setException(Exception exception) {
-        this.exception = exception;
-    }
+/**
+ * Generic Ability for common behavior.
+ */
+public abstract class LibreAbility extends Ability {
 
     /**
-     * 启动activity
+     * reInitialize
+     *
+     * @param ability
+     * @param name
      */
     public void startOpenAbility(Ability ability, String name) {
         Intent intent = new Intent();
@@ -50,9 +43,16 @@ public abstract class HttpAction extends AsyncTask<Void, Void, String>  {
                 .withAbilityName(name)
                 .build();
         intent.setOperation(operation);
-        ability.startAbility(intent);
+        startAbility(intent);
     }
 
+    /**
+     * reInitialize
+     *
+     * @param ability
+     * @param name
+     * @return intent
+     */
     public Intent getIntent(Ability ability, String name) {
         Intent intent = new Intent();
         Operation operation = new Intent.OperationBuilder()
@@ -65,16 +65,26 @@ public abstract class HttpAction extends AsyncTask<Void, Void, String>  {
     }
 
     /**
-     * 启动activity
+     * runUI
+     *
+     * @param runnable
      */
-    public void startOpenAbilityForResult(Ability ability, String name, int requestCode) {
-        Intent intent = new Intent();
-        Operation operation = new Intent.OperationBuilder()
-                .withDeviceId("")
-                .withBundleName(ability.getBundleName())
-                .withAbilityName(name)
-                .build();
-        intent.setOperation(operation);
-        ability.startAbilityForResult(intent, requestCode);
+    public static void runUI(Runnable runnable) {
+        EventHandler eventHandler = new EventHandler(EventRunner.getMainEventRunner());
+        eventHandler.postSyncTask(runnable);
+
+    }
+
+    /**
+     * 子线程执行任务
+     *
+     * @param runnable
+     */
+    public static void runWork(Runnable runnable) {
+        //开启线程
+        EventRunner runner = EventRunner.create(true);
+        EventHandler eventHandler = new EventHandler(runner);
+        eventHandler.postTask(runnable, 0, EventHandler.Priority.IMMEDIATE);
+
     }
-}
\ No newline at end of file
+}
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
index e17e777adae6bd2db8058318775c2eb32db774df..33a4ee3074e9c89fa4f42ef1d7ad0ef8cc1c4637 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
@@ -15,16 +15,16 @@
  *  limitations under the License.
  *
  ******************************************************************************/
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import java.util.ArrayList;
 import java.util.List;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpAction;
-import org.botlibre.sdk.activityy.actions.HttpGetTemplatesAction;
-import org.botlibre.sdk.activityy.avatar.AvatarSelection;
+import org.botlibre.sdk.ability.actions.HttpAction;
+import org.botlibre.sdk.ability.actions.HttpGetTemplatesAction;
+import org.botlibre.sdk.ability.avatar.AvatarSelection;
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
 import org.botlibre.sdk.micro.MicroConnection;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
similarity index 92%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
index 3185099d6ec5187c8bb6e00699b21b68a700fb6c..24ff09cab077a0aae4e07087baf3860e46e49c14 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
@@ -16,15 +16,14 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpConnectAction;
-import org.botlibre.sdk.config.UserConfig;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
 import ohos.agp.components.Component;
 import ohos.agp.components.TextField;
+import org.botlibre.sdk.ResourceTable;
+import org.botlibre.sdk.config.UserConfig;
 
 /**
  * Ability for user login.
@@ -55,8 +54,6 @@ public class LoginAbility extends LibreAbility implements Component.ClickedListe
 		UserConfig config = new UserConfig();
 		config.user = user;
 		config.password = password;
-        HttpConnectAction action = new HttpConnectAction(this, config, true);
-//    	action.execute();
     }
 	
 	public void signUp() {
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/MicConfigAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/MicConfigAbility.java
similarity index 99%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/MicConfigAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/MicConfigAbility.java
index f647130764e407e0672e229f52c498a3ac1db824..4b92cafe10fd7743ff631fcdb55de3ec1d562d5e 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/MicConfigAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/MicConfigAbility.java
@@ -15,7 +15,7 @@
  *  limitations under the License.
  *
  ******************************************************************************/
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 
 import com.czt.mp3recorder.MP3Recorder;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
index 2eecf1a58e97f54b3842f35846a22cd9744d213e..e116182a62d837c446d1da56b49f6bcc61471cf6 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
@@ -16,17 +16,8 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpBrowseCategoriesAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.dialog.SearchDialogBuilder;
-import org.botlibre.sdk.activityy.listener.SelectListener;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.util.PreferencesUtils;
-import org.botlibre.sdk.util.ResUtil;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
 import ohos.agp.components.Checkbox;
@@ -45,6 +36,14 @@ import ohos.agp.window.service.Display;
 import ohos.agp.window.service.DisplayAttributes;
 import ohos.agp.window.service.DisplayManager;
 import ohos.data.preferences.Preferences;
+import org.botlibre.sdk.MainAbility;
+import org.botlibre.sdk.ResourceTable;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.dialog.SearchDialogBuilder;
+import org.botlibre.sdk.ability.listener.SelectListener;
+import org.botlibre.sdk.config.BrowseConfig;
+import org.botlibre.sdk.util.PreferencesUtils;
+import org.botlibre.sdk.util.ResUtil;
 
 import java.util.Optional;
 
@@ -356,8 +355,6 @@ public abstract class SearchAbility extends LibreAbility implements SelectListen
 	}
 
 	public void browseCategories() {
-		HttpBrowseCategoriesAction action = new HttpBrowseCategoriesAction(this, getType(), MainAbility.browsing);
-//		action.execute();
 	}
 
 	@Override
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
similarity index 90%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
index ea8995994363c7013c6660b7e822e3534dc72fb1..f1ebad2573fdfdf6731837f15f1601afbb4532f1 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
@@ -1,11 +1,11 @@
-/*
+/**
  * Copyright (C) 2021 Huawei Device Co., Ltd.
  * Licensed under the Apache License, Version 2.0 (the "License");
  * you may not use this file except in compliance with the License.
  * You may obtain an copy of the License at
- *
+ * <p>
  * http://www.apache.org/licenses/LICENSE-2.0
- *
+ * <p>
  * Unless required by applicable law or agreed to in writing, software
  * distributed under the License is distributed on an "AS IS" BASIS,
  * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
@@ -13,14 +13,14 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.util.AsyncTask;
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
 import ohos.aafwk.content.Operation;
 
-public abstract class HttpAction extends AsyncTask<Void, Void, String> {
+public abstract class HttpAction extends AsyncTask<Void, Void, String>  {
     protected Ability ability;
     protected Exception exception;
 
@@ -37,7 +37,10 @@ public abstract class HttpAction extends AsyncTask<Void, Void, String> {
     }
 
     /**
-     * 启动activity
+     * startOpenAbility
+     *
+     * @param ability
+     * @param name
      */
     public void startOpenAbility(Ability ability, String name) {
         Intent intent = new Intent();
@@ -62,7 +65,11 @@ public abstract class HttpAction extends AsyncTask<Void, Void, String> {
     }
 
     /**
-     * 启动activity
+     * startOpenAbilityForResult
+     *
+     * @param ability
+     * @param name
+     * @param requestCode
      */
     public void startOpenAbilityForResult(Ability ability, String name, int requestCode) {
         Intent intent = new Intent();
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
similarity index 98%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
index cd19265d3126450c04e4f83cffc38a7261debd9a..07ab9d620cf25e2d854134a7a68e484704c519c4 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
index 075e27d04afc91bdaa00e48dae011b509fef58bc..10d8ba353dc581e6ba82f998e130cd3b97c8d051 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
index cf874a13752d47400679af080a94b9ccd29a08cd..52f21351d8c71453369dfb422041544acca447df 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
index c452ff0f9df95e9f895e81ad192ed7213492f4f7..6bdb577e7ef3ded32caed03bd1ff0cce17e63d9a 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
index f67cdd55bc47111f5f6fdcd0f181c4c9a68552f2..9a62ce614d0c85347b230f20d7109e2152162c23 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
index 5aa47a9e544067a0fce951ab5dcfb5c1f6a0ce9b..18f8c053134ddcec820b4da8a35dae99b4a92bd1 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
index 5a02f496400c43e900b6bbcc23d26a615b647ef7..dd17bfa37ed020c91d86d206a3cab2a91abc3dc9 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.MediaConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
index 0b94d353ea519d0f02506a6594146a2876aa19ab..18ff0673a175067bbddea811b127bb7fe77e792a 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
index c2b719f086169b95e0c9bd7fb34dcd6870970c91..2064883e58e361555e972249f0858c1056857ba6 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ForumPostConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
similarity index 86%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
index e3a08dd0f73f2478d254d17929132dcd7eff3971..d0e27b9e029e0249592174751b19031cbe9352f1 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
@@ -16,13 +16,18 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.*;
-import org.botlibre.sdk.util.PreferencesUtils;
 import ohos.aafwk.ability.Ability;
 import ohos.data.preferences.Preferences;
+import org.botlibre.sdk.MainAbility;
+import org.botlibre.sdk.config.BrowseConfig;
+import org.botlibre.sdk.config.ChannelConfig;
+import org.botlibre.sdk.config.DomainConfig;
+import org.botlibre.sdk.config.ForumConfig;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.WebMediumConfig;
+import org.botlibre.sdk.util.PreferencesUtils;
 
 public class HttpFetchAction extends HttpUIResultAction {
 	WebMediumConfig config;
@@ -86,8 +91,6 @@ public class HttpFetchAction extends HttpUIResultAction {
 //	        		childAbility = LiveChatAbility.class;
 	        	} else if (this.config instanceof InstanceConfig) {
 //	        		childAbility = ChatAbility.class;
-					HttpGetVoiceAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-//	        		action.execute();
 	        	} else if (this.config instanceof DomainConfig) {
 	        		MainAbility.connection.setDomain((DomainConfig)this.config);
 	    			MainAbility.domain = (DomainConfig)this.config;
@@ -103,10 +106,7 @@ public class HttpFetchAction extends HttpUIResultAction {
 	    			MainAbility.graphicCategories = null;
 	    			
 	    			MainAbility.type = MainAbility.defaultType;	    			
-//	    	        Intent intent = new Intent(this.ability, MainAbility.class);
-//	    			intent.setFlags(Intent.FLAG_Ability_NEW_TASK);
-//	    			intent.setFlags(Intent.FLAG_Ability_CLEAR_TOP);
-//	    			this.ability.startAbility(intent);
+
 	    			startOpenAbility(this.ability,MainAbility.class.getName());
 	    			return;
 	        	} else if (this.config instanceof ForumConfig) {
@@ -123,8 +123,6 @@ public class HttpFetchAction extends HttpUIResultAction {
 	        	}
         	} else {
         		if (this.config instanceof InstanceConfig) {
-					HttpGetVoiceAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-//	        		action.execute();
 	        	}
         	}
 			startOpenAbility(this.ability,childAbility.getName());
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
index e0ef846b3a366a15c2f7175e0d617dbf16ac78d6..60e055ff9652220789ea2f35446a833013264940 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
index 876e4f00d97462425debd6f85421e70f670742cc..6222aeb7081223e23c9b016988fd98557e0e34ea 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.UserConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
index 7859eeab096d36455c99abd8029e5de02cfec841..9e2aff1ba6938c2632039624bd30bdbd13535388 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
similarity index 99%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
index 710b66f9925d214f033f207c1ee90d339fbc801d..d9eb94280adbd2a4b22908c51895ae16ff014009 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.BrowseConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
index 078f1ed08c11e1be3798303dfe8282dd59983108..40e01a437282e334daf74a2f3f02e0b1d7225302 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.InstanceConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
similarity index 98%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
index 8162d98286151a7c0727c06c60b44a218dcf6ed5..09f2164cca848c27379a0ee2fcad425fd34291e4 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
index 2a8e59efd665ad22441d81beda15829da0519229..cf41f9c81aefcfb292699e84e16057d6138f270b 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
similarity index 98%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
index 489c48c588cf8d894814ccf66f708bbcb309620e..715858b5a3395021ca730f3bda01a5cd45ab8a27 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
similarity index 98%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
index 272969d74471a4ceaf9f84ee2d50d2d06850d58b..f0093abe4928264a0e779a964ff7c836f7cbb33c 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
similarity index 98%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
index 364bee86c2792588d97d9e6be34525b4b4d93301..db20c9023af46e0008fb620fd18187d4a867c22d 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/CommandAdapter.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/CommandAdapter.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/CommandAdapter.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/CommandAdapter.java
index e4f067311ab6af489e7f21709b2ff02ad91ee599..5220844068684f8f28760fb46ecf3de7ff6f0a36 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/CommandAdapter.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/CommandAdapter.java
@@ -13,7 +13,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.adapter;
+package org.botlibre.sdk.ability.adapter;
 
 import org.botlibre.sdk.ResourceTable;
 import ohos.aafwk.ability.Ability;
@@ -33,7 +33,7 @@ import java.util.List;
  * @since 2021-05-10
  */
 public class CommandAdapter extends BaseItemProvider {
-    private final Ability mActivity;
+    private final Ability mAbility;
     private final LayoutScatter mInflater;
     private final List<String> item;
 
@@ -44,7 +44,7 @@ public class CommandAdapter extends BaseItemProvider {
      * @param item    item
      */
     public CommandAdapter(Ability ability, List<String> item) {
-        mActivity = ability;
+        mAbility = ability;
         this.item = item;
         mInflater = LayoutScatter.getInstance(ability);
     }
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/EmoteAdapter.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/EmoteAdapter.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/EmoteAdapter.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/EmoteAdapter.java
index 1ba73463a272792bc13fd564f5e46402ea66f455..b73f21ae2a337f4bab77739657562e47c3297abb 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/EmoteAdapter.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/EmoteAdapter.java
@@ -13,10 +13,10 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.adapter;
+package org.botlibre.sdk.ability.adapter;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.EmotionalState;
+import org.botlibre.sdk.ability.EmotionalState;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.BaseItemProvider;
 import ohos.agp.components.Component;
@@ -35,7 +35,7 @@ import java.util.Locale;
  * @since 2021-05-10
  */
 public class EmoteAdapter extends BaseItemProvider {
-    private final Ability mActivity;
+    private final Ability mability;
     private final LayoutScatter mInflater;
     private final List<EmotionalState> item;
 
@@ -46,7 +46,7 @@ public class EmoteAdapter extends BaseItemProvider {
      * @param item item
      */
     public EmoteAdapter(Ability ability, List<EmotionalState> item) {
-        mActivity = ability;
+        mability = ability;
         this.item = item;
         mInflater = LayoutScatter.getInstance(ability);
     }
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
index 0a708de062101d0f440fbab96dd0eb7051bd493d..6b6e5f7a5b4508551fdbe969d3169da9981da5e5 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
@@ -13,7 +13,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.adapter;
+package org.botlibre.sdk.ability.adapter;
 
 import org.botlibre.sdk.ResourceTable;
 import ohos.aafwk.ability.Ability;
@@ -30,7 +30,7 @@ import ohos.agp.components.Text;
  * @since 2021-05-10
  */
 public class SpinnerAdapter extends BaseItemProvider {
-    private final Ability mActivity;
+    private final Ability mAbility;
     private final LayoutScatter mInflater;
     private final String[] types;
 
@@ -41,7 +41,7 @@ public class SpinnerAdapter extends BaseItemProvider {
      * @param types types
      */
     public SpinnerAdapter(Ability ability, String[] types) {
-        mActivity = ability;
+        mAbility = ability;
         this.types = types;
         mInflater = LayoutScatter.getInstance(ability);
     }
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
similarity index 74%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
index 1ba617525f7f0225dbdb153a853e35ffcc005dd1..a75ead36800635748095bc8f89239222aa9e7517 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.avatar;
+package org.botlibre.sdk.ability.avatar;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
@@ -31,14 +31,13 @@ import ohos.data.preferences.Preferences;
 import java.util.ArrayList;
 
 /**
- * Activity used for selecting an offline avatar.
+ *  used for selecting an offline avatar.
  */
 public class AvatarSelection extends Ability {
 
 	@Override
 	public void onStart(Intent intent) {
 		super.onStart(intent);
-//		setContentView(R.layout.activity_list_view);
 		super.setUIContent(ResourceTable.Layout_ability_list_view);
 		final int [] imges = {};
 		final String [] names = {};
@@ -48,16 +47,7 @@ public class AvatarSelection extends Ability {
 		for (int i = 0; i < names.length; i++) {
 			items.add(new OfflineTemplateConfig(imges[i],names[i],null,null));
 		}
-//		CustomListViewAdapter adapter = new CustomListViewAdapter(this, R.layout.list_item_imager, items);
-//		listView.setAdapter(adapter);
-//		listView.setOnItemClickListener(new OnItemClickListener(){
-//			@Override
-//			public void onItemClick(AdapterView<?> parent, View view, int position, long id) {
-//				OfflineTemplateConfig template = (OfflineTemplateConfig) (listView.getItemAtPosition(position));
-//				saveSelectedAvatar(template.getTitle());
-//				MainActivity.readZipAvatars(AvatarSelection.this, MainActivity.nameOfAvatar);
-//				finish();
-//			}});
+
 	}
 
 	public static void saveSelectedAvatar(String nameOfAvatar) {
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
index c15fc3a71ee6f86d77cbb6fcd913ea40914d24b5..b14752da2ad09c11c8ac78699949724ab1af4531 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
@@ -13,12 +13,12 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.LanguageListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.LanguageListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
index a1f99136eee7867944196c488934bdfef0482374..34c67053c103c3e2a87c24dca243287ed1c7ee15 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
@@ -13,11 +13,11 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
index 929116aa9dc948e3e73c7225d35bcad2c4b79efe..d8caef1fa97f65a4d41c50e0c281907e74135f3d 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
@@ -13,12 +13,12 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
similarity index 74%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
index 776ecddd89448fdd01e97b8cd024a4ce6736c227..4891ad77f15c789b234f6b0f7b565c994856f54e 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
@@ -16,15 +16,18 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.listener;
+package org.botlibre.sdk.ability.listener;
 
 /**
- * Listener interface for a LiveChatConnection.
- * This gives asynchronous notification when a channel receives a message, or notice.
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
  */
 public interface LanguageListener {
-	/**
-	 * A user message was received from the channel.
-	 */
-	void selectLanguageItem(String select);
+    /**
+     * selectLanguageItem
+     *
+     * @param select
+     */
+    void selectLanguageItem(String select);
 }
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
similarity index 95%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
index 237a4130230d4315b6104d3b10fd8da115e72fed..8196de407603a5e68a3766dcf063c0bc1faedeff 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.listener;
+package org.botlibre.sdk.ability.listener;
 
 /**
  * Listener interface for a LiveChatConnection.
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
similarity index 95%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
index f943da9e2cbeee5b38c510ba220f2c56237be175..7d0c9ee38abd0e72dae4d758dbfb3b6108be35eb 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
@@ -1,4 +1,4 @@
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 import org.botlibre.sdk.config.Config;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
similarity index 80%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
index ac0405d955ae27c6ef32f219ba714625c676f441..1c0419f9a72e8569c22923923a87c3b55b740012 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
@@ -1,7 +1,7 @@
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.actions.HttpUIAction;
+import org.botlibre.sdk.ability.actions.HttpUIAction;
 import org.botlibre.sdk.config.InstanceConfig;
 import ohos.aafwk.ability.Ability;
 
@@ -9,8 +9,8 @@ public class HttpChatWarAction extends HttpUIAction {
 	ChatWarConfig config;
 	InstanceConfig instance;
 
-	public HttpChatWarAction(Ability activity, ChatWarConfig config) {
-		super(activity);
+	public HttpChatWarAction(Ability ability, ChatWarConfig config) {
+		super(ability);
 		this.config = config;
 	}
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
similarity index 95%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java
rename to BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
index 0e3bb78a893e66f9befea773c0a0eb53c5276bda..b6be798ad96564bc3cf0c82b461dad5c727471ba 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
@@ -16,24 +16,23 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.LibreAbility;
-import org.botlibre.sdk.activityy.actions.HttpFetchWarAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.util.PreferencesUtils;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
 import ohos.agp.components.Component;
 import ohos.agp.components.Text;
 import ohos.agp.components.TextField;
 import ohos.data.preferences.Preferences;
+import org.botlibre.sdk.MainAbility;
+import org.botlibre.sdk.ResourceTable;
+import org.botlibre.sdk.ability.LibreAbility;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.config.BrowseConfig;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.WebMediumConfig;
+import org.botlibre.sdk.util.PreferencesUtils;
 
 import java.util.ArrayList;
 import java.util.List;
@@ -71,8 +70,6 @@ public class StartWarAbility extends LibreAbility implements Component.ClickedLi
 			if (last != null && !last.isEmpty()) {
 				InstanceConfig config = new InstanceConfig();
 				config.name = last;
-				HttpFetchWarAction action = new HttpFetchWarAction(this, config);
-//				action.execute();
 			}
 		}
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java
deleted file mode 100644
index 4ec832b535342111beaf7bffa7ab9b86ba105703..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java
+++ /dev/null
@@ -1,92 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy;
-
-import ohos.aafwk.ability.Ability;
-import ohos.aafwk.content.Intent;
-import ohos.aafwk.content.Operation;
-import ohos.eventhandler.EventHandler;
-import ohos.eventhandler.EventRunner;
-
-/**
- * Generic Ability for common behavior.
- */
-public abstract class LibreAbility extends Ability {
-
-	public void help() {
-//		Intent intent = new Intent();
-//		Operation operation = new Intent.OperationBuilder()
-//				.withDeviceId("")
-//				.withBundleName(this.getBundleName())
-//				.withAbilityName(HelpAbility.class.getName())
-//				.build();
-//		intent.setOperation(operation);
-//		startAbility(intent);
-	}
-
-	/**
-	 * 启动activity
-	 */
-	public void startOpenAbility(Ability ability,String name){
-		Intent intent = new Intent();
-		Operation operation = new Intent.OperationBuilder()
-				.withDeviceId("")
-				.withBundleName(ability.getBundleName())
-				.withAbilityName(name)
-				.build();
-		intent.setOperation(operation);
-		startAbility(intent);
-	}
-
-	/**
-	 * getIntent
-	 */
-	public Intent getIntent(Ability ability, String name) {
-		Intent intent = new Intent();
-		Operation operation = new Intent.OperationBuilder()
-				.withDeviceId("")
-				.withBundleName(ability.getBundleName())
-				.withAbilityName(name)
-				.build();
-		intent.setOperation(operation);
-		return intent;
-	}
-
-	/**
-	 * 主线程执行任务
-	 * @param runnable
-	 */
-	public static void runUI(Runnable runnable){
-		EventHandler eventHandler=new EventHandler(EventRunner.getMainEventRunner());
-		eventHandler.postSyncTask(runnable);
-
-	}
-
-	/**
-	 * 子线程执行任务
-	 * @param runnable
-	 */
-	public static void runWork(Runnable runnable){
-		//开启线程
-		EventRunner runner=EventRunner.create(true);
-		EventHandler eventHandler=new EventHandler(runner);
-		eventHandler.postTask(runnable,0, EventHandler.Priority.IMMEDIATE);
-
-	}
-}
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java
deleted file mode 100644
index 29908b218bfe4750d35e4c029d610e48d10aebf7..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java
+++ /dev/null
@@ -1,141 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarMessage;
-import org.botlibre.sdk.config.ChatResponse;
-import ohos.aafwk.ability.Ability;
-
-public class HttpAvatarMessageAction extends HttpAction {
-	AvatarMessage config;
-	ChatResponse response;
-
-	public HttpAvatarMessageAction(Ability ability, AvatarMessage config) {
-		super(ability);
-		this.config = config;
-	}
-
-	protected String doInBackground(Void... params) {
-		try {
-		this.response = MainAbility.connection.avatarMessage(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	protected void onPostExecute(String xml) {
-		if (this.exception != null) {
-			MainAbility.errorInfo(1,this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		try {
-//			final AvatarTestAbility ability = (AvatarTestAbility)this.ability;
-//
-//			Image imageView = (Image)ability.findViewById(R.id.imageView);
-//			final VideoView videoView = (VideoView)Ability.findViewById(R.id.videoView);
-//			View videoLayout = Ability.findViewById(R.id.videoLayout);
-//
-//			if (MainAbility.sound && this.response.avatarActionAudio != null && this.response.avatarActionAudio.length() > 0) {
-//				// Action audio
-//				Ability.playAudio(this.response.avatarActionAudio, false, true, true);
-//			}
-//			if (MainAbility.sound && this.response.avatarAudio != null && this.response.avatarAudio.length() > 0) {
-//				// Background audio
-//				if (!this.response.avatarAudio.equals(Ability.currentAudio)) {
-//					if (Ability.audioPlayer != null) {
-//						Ability.audioPlayer.stop();
-//						Ability.audioPlayer.release();
-//					}
-//					Ability.audioPlayer = Ability.playAudio(this.response.avatarAudio, true, true, true);
-//				}
-//			} else if (Ability.audioPlayer != null) {
-//				Ability.audioPlayer.stop();
-//				Ability.audioPlayer.release();
-//				Ability.audioPlayer = null;
-//			}
-//
-//			if (!MainAbility.disableVideo && !Ability.videoError && this.response.isVideo()) {
-//				// Video avatar
-//				if (imageView.getVisibility() != View.GONE || videoLayout.getVisibility() != View.GONE) {
-//					if (imageView.getVisibility() == View.VISIBLE) {
-//						imageView.setVisibility(View.GONE);
-//					}
-//					if (videoLayout.getVisibility() == View.GONE) {
-//						videoLayout.setVisibility(View.VISIBLE);
-//					}
-//				}
-//				if (this.response.avatarAction != null && this.response.avatarAction.length() > 0) {
-//					// Action video
-//					videoView.setOnPreparedListener(new OnPreparedListener() {
-//						@Override
-//						public void onPrepared(MediaPlayer mp) {
-//							mp.setLooping(false);
-//						}
-//					});
-//					videoView.setOnCompletionListener(new OnCompletionListener() {
-//						@Override
-//						public void onCompletion(MediaPlayer mp) {
-//							Ability.resetVideoErrorListener();
-//							videoView.setOnCompletionListener(null);
-//							Ability.playVideo(response.avatar, true);
-//							Ability.response(response);
-//						}
-//					});
-//					videoView.setOnErrorListener(new OnErrorListener() {
-//						@Override
-//						public boolean onError(MediaPlayer mp, int what, int extra) {
-//							Ability.resetVideoErrorListener();
-//							Ability.playVideo(response.avatar, true);
-//							Ability.response(response);
-//							return true;
-//						}
-//					});
-//					Ability.playVideo(this.response.avatarAction, false);
-//					return;
-//				} else {
-//					Ability.playVideo(this.response.avatar, true);
-//				}
-//			} else {
-//				// Image avatar
-//				if (imageView.getVisibility() != View.GONE || videoLayout.getVisibility() != View.GONE) {
-//					if (imageView.getVisibility() == View.GONE) {
-//						imageView.setVisibility(View.VISIBLE);
-//					}
-//					if (videoLayout.getVisibility() == View.VISIBLE) {
-//						videoLayout.setVisibility(View.GONE);
-//					}
-//				}
-//				if (response.isVideo()) {
-//					HttpGetImageAction.fetchImage(this.ability, MainAbility.instance.avatar, imageView);
-//				} else {
-//					HttpGetImageAction.fetchImage(this.ability, this.response.avatar, imageView);
-//				}
-//			}
-//
-//			Ability.response(this.response);
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java
deleted file mode 100644
index 8f69368d93b07ec97733b14bb5fc6aee7b245456..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java
+++ /dev/null
@@ -1,117 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import ohos.aafwk.ability.Ability;
-import org.botlibre.sdk.config.ContentConfig;
-
-
-public class HttpBrowseCategoriesAction extends HttpUIResultAction {
-	ContentConfig config;
-	Object[] categories;
-	boolean finish;
-	
-	public HttpBrowseCategoriesAction(Ability ability, String type, boolean finish) {
-		super(ability);
-		this.config = new ContentConfig();
-		this.config.type = type;
-		this.finish = finish;
-		doInBackground();
-	}
-
-	public void doInBackground(){
-		loadingDialog();
-		if (this.config.type.equals("Bot") && MainAbility.categories != null) {
-			this.categories = MainAbility.categories;
-		} else if (this.config.type.equals("Forum") && MainAbility.forumCategories != null) {
-			this.categories = MainAbility.forumCategories;
-		} else if (this.config.type.equals("Channel") && MainAbility.channelCategories != null) {
-			this.categories = MainAbility.channelCategories;
-		} else if (this.config.type.equals("Avatar") && MainAbility.avatarCategories != null) {
-			this.categories = MainAbility.avatarCategories;
-		} else if (this.config.type.equals("Script") && MainAbility.scriptCategories != null) {
-			this.categories = MainAbility.scriptCategories;
-		} else if (this.config.type.equals("Domain")) {
-			this.categories = new Object[0];
-		} else {
-			try {
-				this.categories = MainAbility.connection.getCategories(this.config).toArray();
-			} catch (Exception exception) {
-				this.exception = exception;
-				this.categories = new Object[0];
-				removeDialog();
-			}
-		}
-	}
-//	@Override
-//	protected String doInBackground(Void... params) {
-//		if (this.config.type.equals("Bot") && MainAbility.categories != null) {
-//			this.categories = MainAbility.categories;
-//		} else if (this.config.type.equals("Forum") && MainAbility.forumCategories != null) {
-//			this.categories = MainAbility.forumCategories;
-//		} else if (this.config.type.equals("Channel") && MainAbility.channelCategories != null) {
-//			this.categories = MainAbility.channelCategories;
-//		} else if (this.config.type.equals("Avatar") && MainAbility.avatarCategories != null) {
-//			this.categories = MainAbility.avatarCategories;
-//		} else if (this.config.type.equals("Script") && MainAbility.scriptCategories != null) {
-//			this.categories = MainAbility.scriptCategories;
-//		} else if (this.config.type.equals("Domain")) {
-//			this.categories = new Object[0];
-//		} else {
-//			try {
-//				this.categories = MainAbility.connection.getCategories(this.config).toArray();
-//			} catch (Exception exception) {
-//				this.exception = exception;
-//				this.categories = new Object[0];
-//			}
-//		}
-//		return "";
-//	}
-
-
-
-	@SuppressWarnings("unchecked")
-//	@Override
-	public void onPostExecute(String xml) {
-		if (this.exception != null) {
-			return;
-		}
-		if (this.config.type.equals("Bot")) {
-			MainAbility.categories = this.categories;
-		} else if (this.config.type.equals("Forum")) {
-			MainAbility.forumCategories = this.categories;
-		} else if (this.config.type.equals("Channel")) {
-			MainAbility.channelCategories = this.categories;
-		} else if (this.config.type.equals("Avatar")) {
-			MainAbility.avatarCategories = this.categories;
-		} else if (this.config.type.equals("Script")) {
-			MainAbility.scriptCategories = this.categories;
-		}
-		if (this.finish) {
-			this.ability.terminateAbility();
-		}
-		
-//		BrowseCategoriesAbility.type = this.config.type;
-//		BrowseCategoriesAbility.instances = (List<ContentConfig>)(Object)Arrays.asList(this.categories);
-//		startOpenAbility(this.ability,);
-//        Intent intent = new Intent(this.ability, BrowseCategoriesAbility.class);
-//        this.ability.startAbility(intent);
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java
deleted file mode 100644
index ea62e54ec97744105480b532ddb5cfd1f8edcec2..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java
+++ /dev/null
@@ -1,62 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpChangeIconAction extends HttpUIAction {
-
-	WebMediumConfig config;
-	String file;
-	
-	public HttpChangeIconAction(Ability ability, String file, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-		this.file = file;
-	}
-
-//	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.updateIcon(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-//	@Override
-	public void onPostExecute(String xml) {
-//		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-//			((WebMediumAdminAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-    }
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java
deleted file mode 100644
index ebe30d723709f462d054cc84ae0a765562260f0e..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java
+++ /dev/null
@@ -1,70 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.config.ChatConfig;
-import org.botlibre.sdk.config.ChatResponse;
-import ohos.aafwk.ability.Ability;
-
-
-public class HttpChatAction extends HttpAction {
-    ChatConfig config;
-    ChatResponse response;
-
-    public HttpChatAction(Ability ability, ChatConfig config) {
-        super(ability);
-        this.config = config;
-        doInBackground();
-    }
-
-
-    @Override
-    protected String doInBackground(Void... voids) {
-        try {
-            this.response = MainAbility.connection.chat(this.config);
-        } catch (Exception exception) {
-            this.exception = exception;
-        }
-        return "";
-    }
-
-
-    protected void onPostExecute(String xml) {
-        if (this.config.disconnect) {
-            return;
-        }
-        if (this.exception != null) {
-            MainAbility.errorInfo(1, this.exception.getMessage(), this.exception, this.ability);
-            return;
-        }
-        try {
-            MainAbility.conversation = this.response.conversation;
-            final ChatAbility ability = (ChatAbility) this.ability;
-
-            ability.response(this.response);
-        } catch (Exception error) {
-            this.exception = error;
-            MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-            return;
-        }
-    }
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java
deleted file mode 100644
index 887de2ed158e3731e4593a769acbc8973dbf7bd6..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java
+++ /dev/null
@@ -1,86 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserConfig;
-import org.botlibre.sdk.util.PreferencesUtils;
-import ohos.aafwk.ability.Ability;
-import ohos.data.preferences.Preferences;
-
-public class HttpConnectAction extends HttpUIResultAction {
-    UserConfig config;
-    boolean finish;
-
-    public HttpConnectAction(Ability ability, UserConfig config, boolean finish) {
-        super(ability);
-        this.config = config;
-        this.finish = finish;
-        doInBackground();
-    }
-
-//    @Override
-    public void doInBackground() {
-        loadingDialog();
-        try {
-            this.config = MainAbility.connection.connect(config);
-        } catch (Exception exception) {
-            this.exception = exception;
-            removeDialog();
-        }
-        onPostExecute();
-    }
-
-//    @Override
-    protected void onPostExecute() {
-//        super.onPostExecute(xml);
-        if (this.exception != null) {
-            return;
-        }
-        try {
-            MainAbility.user = this.config;
-            if (this.ability instanceof MainAbility) {
-                ((MainAbility) this.ability).resetView();
-            }
-
-            if (this.finish) {
-
-                Preferences cookies = PreferencesUtils.getPreferences(ability);
-                cookies.putString("user", MainAbility.user.user);
-                cookies.putString("token", MainAbility.user.token);
-                cookies.flushSync();
-
-                this.ability.terminateAbility();
-            }
-
-        } catch (Exception error) {
-            this.exception = error;
-            MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-
-            Preferences cookies=PreferencesUtils.getPreferences(this.ability);
-            cookies.putString("user", null);
-            cookies.putString("token", null);
-            cookies.flushSync();
-            return;
-        }
-    }
-
-
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java
deleted file mode 100644
index 4893832d1dcc10063bf074880eb26b74b4d0ad72..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java
+++ /dev/null
@@ -1,68 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpCreateIssueAction extends HttpUIAction {
-
-	IssueConfig config;
-
-	public HttpCreateIssueAction(Ability ability, IssueConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.create(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.issue = this.config;
-	        MainAbility.issues.add(0, this.config);
-			
-			this.ability.terminateAbility();
-	    	
-	        //Intent intent = new Intent(this.ability, IssueAbility.class);
-	        //this.ability.startAbility(intent);
-	        
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java
deleted file mode 100644
index b4e9a82d1eeb2b498226a3ee9d84f08083d047f7..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java
+++ /dev/null
@@ -1,56 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserMessageConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpCreateUserMessageAction extends HttpUIAction {
-	
-	UserMessageConfig config;
-
-	public HttpCreateUserMessageAction(Ability ability, UserMessageConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.createUserMessage(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-    	
-		this.ability.terminateAbility();
-    }
-
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java
deleted file mode 100644
index 96c1a4f2640ac21fa5cf7650a1e3a3a34fb08299..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.util.PreferencesUtils;
-import ohos.aafwk.ability.Ability;
-import ohos.data.preferences.Preferences;
-
-public class HttpDeleteAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpDeleteAction(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-        MainAbility.wasDelete = true;
-        MainAbility.instances.remove(this.config);
-
-		Preferences cookies= PreferencesUtils.getPreferences(this.ability);
-    	cookies.putString(this.config.getType(), null);
-    	cookies.flushSync();
-    	
-		this.ability.terminateAbility();
-    }
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java
deleted file mode 100644
index 3ab854bdaf1593140f1403ad73108934507495e5..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java
+++ /dev/null
@@ -1,56 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.AvatarMedia;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpDeleteAvatarMediaAction extends HttpUIAction {
-
-	AvatarMedia config;
-	
-	public HttpDeleteAvatarMediaAction(Ability ability, AvatarMedia config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		HttpAction action = new HttpGetAvatarMediaAction(this.ability, (AvatarConfig)MainAbility.instance.credentials(), true);
-		action.execute();
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java
deleted file mode 100644
index e516361666951b2838f11f84958294129463073d..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpDeleteBotScriptAction extends HttpUIAction {
-
-	ScriptSourceConfig config;
-	
-	public HttpDeleteBotScriptAction(Ability ability, ScriptSourceConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.deleteBotScript(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.script = this.config;
-
-//		((BotScriptsAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java
deleted file mode 100644
index cada6fec28e004811db166f830e9d8bf3874940a..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java
+++ /dev/null
@@ -1,85 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2017 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.activityy.ListTemplateView;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.micro.MicroConnection;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFetchActionOffline extends HttpUIResultAction {
-	WebMediumConfig config;
-	MicroConnection microConnection = new MicroConnection();
-	boolean launch;
-
-	public HttpFetchActionOffline(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	
-	public HttpFetchActionOffline(Ability ability, WebMediumConfig config, boolean launch) {
-		super(ability);
-		this.config = config;
-		this.launch = launch;
-		doInBackground();
-	}
-
-	protected void doInBackground() {
-		try {
-			MainAbility.setOnline(false);
-			microConnection = (MicroConnection) MainAbility.connection;
-			this.config = microConnection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-			return;
-		}
-
-		onPostExecute();
-	}
-
-	public void onPostExecute() {
-		if(this.ability instanceof ListTemplateView){
-			this.ability.terminateAbility();
-		}
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-			Class childAbility = MainAbility.getActivity(this.config);
-			if (this.launch && !this.config.isExternal) {
-				if (this.config instanceof InstanceConfig) {
-					childAbility = ChatAbility.class;
-//					HttpGetVoiceAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-//					action.execute();
-				}
-			}
-			startOpenAbility(this.ability,childAbility.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java
deleted file mode 100644
index 92293cf14d773a4088d7d6b5c162cab10dc7b691..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFlagAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpFlagAction(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.flag(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.instance.isFlagged = true;
-//	    this.ability.findComponentById(ResourceTable.flaggedLabel).setVisibility(View.VISIBLE);
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java
deleted file mode 100644
index 8405db85144d1a04de0662c6c208df09284acff4..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ConversationConfig;
-import org.botlibre.sdk.config.ResponseSearchConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.List;
-
-public class HttpGetConversationsAction extends HttpUIAction {
-
-	ResponseSearchConfig config;
-	List<ConversationConfig> conversations;
-	
-	public HttpGetConversationsAction(Ability ability, ResponseSearchConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.conversations = MainAbility.connection.getConversations(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((TrainingAbility)this.ability).setConversations(this.conversations);
-//			((TrainingAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java
deleted file mode 100644
index 7aeccc1f7248492df6cd3d373236ced01e6c105d..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java
+++ /dev/null
@@ -1,61 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BotModeConfig;
-import org.botlibre.sdk.config.ForumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpGetForumBotModeAction extends HttpUIAction {
-	ForumConfig config;
-	BotModeConfig botMode;
-
-	public HttpGetForumBotModeAction(Ability ability, ForumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.botMode = MainAbility.connection.getForumBotMode(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.botMode = this.botMode;
-			
-//			((ForumBotAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java
deleted file mode 100644
index 12cd38a8ac1c9176d7d0b12465ac434b423393d0..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java
+++ /dev/null
@@ -1,286 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.io.File;
-import java.io.FileOutputStream;
-import java.io.InputStream;
-import java.lang.ref.SoftReference;
-import java.net.URL;
-import java.util.Hashtable;
-import java.util.Map;
-
-import org.botlibre.sdk.MainAbility;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.components.Component;
-import ohos.agp.components.Image;
-import ohos.app.Context;
-import ohos.media.image.PixelMap;
-
-public class HttpGetImageAction extends HttpAction {
-	public static int MAX_HEIGHT = 1200;
-	public static int MAX_WIDTH = 600;
-	public static int MAX_FILES = 100;
-	
-	public static volatile boolean downloading;
-	
-	public static File cacheDir;
-	public static Map<String, SoftReference<PixelMap>> imageCache = new Hashtable<String, SoftReference<PixelMap>>();
-	
-	String image;
-	PixelMap bmp;
-	Image view;
-	
-	
-	
-	public static void setImage(int imageId, Component view){
-		if(view instanceof Image){
-//			((Image) view).setImageResource(imageId);
-		}
-	}
-	
-	public static void clearFileCache(Context context) {
-		try {
-			File[] files = getFileCacheDir(context).listFiles();
-	        if (files == null) {
-	            return;
-	        }
-	        for (File file : files) {
-	        	if (file.isDirectory()) {
-	        		File[] nested = file.listFiles();
-	    	        for (File nestedFile : nested) {
-	    	        	if (!nestedFile.isDirectory()) {
-	    	        		nestedFile.delete();
-	    	        	}
-	    	        }
-	        	} else {
-	        		file.delete();
-	        	}
-	        }
-		} catch (Exception failed) {
-//			Log.wtf(failed.toString(), failed);
-		}
-    }
-	
-    public static File getFileCacheDir(Context context) {
-    	if (cacheDir == null) {
-    		try {
-		            cacheDir = context.getCacheDir();
-		        if (!cacheDir.exists()) {
-		            cacheDir.mkdirs();
-		        }
-    		} catch (Exception failed) {
-    			failed.printStackTrace();
-    			return null;
-    		}
-    	}
-    	return cacheDir;
-    }
-    
-    public static File getFile(String filename, Context context) {
-    	File dir = getFileCacheDir(context);
-    	if (dir == null) {
-    		return null;
-    	}
-    	
-    	File file = new File(dir.getAbsolutePath() + "/" + filename);
-    	dir = new File(file.getParent());
-    	if (!dir.exists()) {
-    		dir.mkdir();
-    	} else {
-	        File[] files = dir.listFiles();
-	    	if (files.length > MAX_FILES) {
-    	        for (File nestedFile : files) {
-    	        	if (!nestedFile.isDirectory()) {
-    	        		nestedFile.delete();
-    	        	}
-    	        }	    		
-	    	}
-    	}
-    	return file;
-    }
-	
-    public static File getFile(String dirName, String filename, Context context) {
-    	File dir = getFileCacheDir(context);
-    	if (dir == null) {
-    		return null;
-    	}
-    	
-    	File file = new File(dir.getAbsolutePath() + "/" + dirName + "/" + filename);
-    	dir = new File(file.getParent());
-    	if (!dir.exists()) {
-    		dir.mkdir();
-    	} else {
-	        File[] files = dir.listFiles();
-	    	if (files.length > MAX_FILES) {
-    	        for (File nestedFile : files) {
-    	        	if (!nestedFile.isDirectory()) {
-    	        		nestedFile.delete();
-    	        	}
-    	        }	    		
-	    	}
-    	}
-    	return file;
-    }
-	
-	public static void fetchImage(Ability Ability, String image, Image view) {
-		if (image == null) {
-			return;
-		}
-		SoftReference<PixelMap> ref = imageCache.get(image);
-		if (ref != null) {
-			PixelMap bmp = ref.get();
-			if (bmp != null) {
-				if (view instanceof Image) {
-					view.setPixelMap(bmp);
-				}
-		        return;
-			}
-		}
-        HttpGetImageAction action = new HttpGetImageAction(Ability, image, view);
-    	try {
-    		action.execute().get();
-    		action.postExecute();
-    		if (action.getException() != null) {
-    			throw action.getException();
-    		}
-    	} catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-    		return;
-    	}
-	}
-	
-	public HttpGetImageAction(Ability Ability) {
-		super(Ability);
-	}
-	
-	public HttpGetImageAction(Ability Ability, String image, Image view) {
-		super(Ability);
-		this.image = image;
-		this.view = view;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-        try {
-	        URL url = MainAbility.connection.fetchImage(this.image);
-		    
-		    /*BitmapFactory.Options options = new BitmapFactory.Options();
-		    options.inJustDecodeBounds = true;
-		    long start = System.currentTimeMillis();
-		    InputStream stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream, null, options);
-		    stream.close();
-		    System.out.println("decodeStream1:" + (System.currentTimeMillis() - start));
-
-	        int height = options.outHeight;
-	        int width = options.outWidth;
-	        options.inPreferredConfig = Bitmap.Config.RGB_565;
-	        int inSampleSize = 1;
-
-	        if (height > MAX_HEIGHT) {
-	            inSampleSize = Math.round((float)height / (float)MAX_HEIGHT);
-	        }
-
-	        int expectedWidth = width / inSampleSize;
-
-	        if (expectedWidth > MAX_WIDTH) {
-	            inSampleSize = Math.round((float)width / (float)MAX_WIDTH);
-	        }
-
-		    options.inSampleSize = inSampleSize;
-		    options.inJustDecodeBounds = false;
-
-		    start = System.currentTimeMillis();
-		    stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream, null, options).recycle();
-		    stream.close();
-		    System.out.println("decodeStream2:" + (System.currentTimeMillis() - start));
-
-		    start = System.currentTimeMillis();
-		    stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream).recycle();
-		    stream.close();
-		    System.out.println("decodeStream-full:" + (System.currentTimeMillis() - start));*/
-
-		    File file = getFile(this.image, this.ability);
-		    if (!file.exists()) {
-		    	downloading = true;
-		    	file.createNewFile();
-		    	FileOutputStream outputStream = new FileOutputStream(file);
-			    InputStream stream = url.openConnection().getInputStream();
-		    	byte[] bytes= new byte[1024];
-		    	int count = 0;
-	            while (count != -1) {
-	            	count = stream.read(bytes, 0, 1024);
-		            if (count == -1) {
-		            	break;
-		            }
-		            outputStream.write(bytes, 0, count);
-	            }
-	            stream.close();
-	            outputStream.close();
-		    	downloading = false;
-		    }
-
-//		    BitmapFactory.Options options = new BitmapFactory.Options();
-//		    options.inJustDecodeBounds = true;
-//		    InputStream stream = new FileInputStream(file);
-//		    BitmapFactory.decodeStream(stream, null, options);
-//		    stream.close();
-//
-//	        int height = options.outHeight;
-//	        int width = options.outWidth;
-//	        options.inPreferredConfig = Bitmap.Config.RGB_565;
-//	        int inSampleSize = 1;
-//	        if (height > MAX_HEIGHT) {
-//	            inSampleSize = Math.round((float)height / (float)MAX_HEIGHT);
-//	        }
-//	        int expectedWidth = width / inSampleSize;
-//	        if (expectedWidth > MAX_WIDTH) {
-//	            inSampleSize = Math.round((float)width / (float)MAX_WIDTH);
-//	        }
-//		    options.inSampleSize = inSampleSize;
-//		    options.inJustDecodeBounds = false;
-//
-//		    stream = new FileInputStream(file);
-//		    this.bmp = BitmapFactory.decodeStream(stream, null, options);
-//		    stream.close();
-//
-//	        imageCache.put(this.image, new SoftReference<Bitmap>(this.bmp));
-	        return "";
-        } catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-        }
-        return null;
-	}
-
-	protected void postExecute() {
-		if (view instanceof Image) {
-//			((Image)view).setImageBitmap(bmp);
-		}
-//		else if (view instanceof Button) {
-////			((Button)view).setBackgroundDrawable(new BitmapDrawable(view.getResources(), bmp));
-//		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java
deleted file mode 100644
index b3a658f477c801e9aa4ce2de9ed20de10044954f..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java
+++ /dev/null
@@ -1,95 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ContentConfig;
-import ohos.aafwk.ability.Ability;
-
-import javax.swing.text.html.ListView;
-
-public class HttpGetTagsAction extends HttpAction {
-	ContentConfig config;
-	Object[] tags;
-	ListView llview;
-	
-	public HttpGetTagsAction(Ability Ability, String type) {
-		super(Ability);
-		this.config = new ContentConfig();
-		this.config.type = type;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		if (this.config.type.equals("Bot") && MainAbility.tags != null) {
-			this.tags = MainAbility.tags;
-		} else if (this.config.type.equals("Forum") && MainAbility.forumTags != null) {
-			this.tags = MainAbility.forumTags;
-		} else if (this.config.type.equals("Post") && MainAbility.forumPostTags != null) {
-			this.tags = MainAbility.forumPostTags;
-		} else if (this.config.type.equals("Channel") && MainAbility.channelTags != null) {
-			this.tags = MainAbility.channelTags;
-		} else if (this.config.type.equals("Avatar") && MainAbility.avatarTags != null) {
-			this.tags = MainAbility.avatarTags;
-		} else if (this.config.type.equals("Script") && MainAbility.scriptTags != null) {
-			this.tags = MainAbility.scriptTags;
-		} else if (this.config.type.equals("Domain") && MainAbility.domainTags != null) {
-//-------			//it's not passing anything
-//			this.tags = new Object[0];
-			//Clean up the domain
-			this.config.domain = null;
-			this.tags = MainAbility.domainTags;
-		} else {
-			try {
-				this.tags = MainAbility.connection.getTags(this.config).toArray();
-			} catch (Exception exception) {
-				this.exception = exception;
-			}
-		}
-		return "";
-	}
-
-	@SuppressWarnings({ "rawtypes", "unchecked" })
-	@Override
-	public void onPostExecute(String xml) {
-		if (this.exception != null) {
-			return;
-		}
-		if (this.config.type.equals("Bot")) {
-			MainAbility.tags = this.tags;
-		} else if (this.config.type.equals("Forum")) {
-			MainAbility.forumTags = this.tags;
-		} else if (this.config.type.equals("Post")) {
-			MainAbility.forumPostTags = this.tags;
-		} else if (this.config.type.equals("Channel")) {
-			MainAbility.channelTags = this.tags;
-		} else if (this.config.type.equals("Avatar")) {
-			MainAbility.avatarTags = this.tags;
-		} else if (this.config.type.equals("Script")) {
-			MainAbility.scriptTags = this.tags;
-		}else if(this.config.type.equals("Domain")){
-			
-			//added domainTags
-			MainAbility.domainTags = this.tags;
-		}
-		
-
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java
deleted file mode 100644
index fa59737fed7c834f60f88e4b4b0b9925aad5ca5a..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java
+++ /dev/null
@@ -1,107 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.io.File;
-import java.io.FileOutputStream;
-import java.io.InputStream;
-import java.net.URL;
-
-import org.botlibre.sdk.MainAbility;
-
-import ohos.aafwk.ability.Ability;
-import ohos.utils.net.Uri;
-
-public class HttpGetVideoAction extends HttpGetImageAction {
-	
-	String video;
-	
-	public static Uri fetchVideo(Ability Ability, String video) {
-//		if(!MainAbility.online){
-//			 File file = getFile(GetAvatarAction.nameOfFile,video, Ability);
-//			 return Uri.getUriFromFile(file);
-//		}
-		
-		if (video == null) {
-			return null;
-		}
-		
-    	if (downloading) {
-    		return null;
-    	}
-	    File file = getFile(video, Ability);
-	    if (file.exists()) {
-	    	if (downloading) {
-	    		return null;
-	    	}
-	    	return Uri.getUriFromFile(file);
-	    }
-			HttpGetVideoAction action = new HttpGetVideoAction(Ability, video);
-			try {
-				action.execute().get();
-				if (action.getException() != null) {
-					throw action.getException();
-				}
-			} catch (Exception exception) {
-				if (MainAbility.DEBUG) {
-					exception.printStackTrace();
-				}
-			}
-		return Uri.getUriFromFile(file);
-	}
-	
-	public HttpGetVideoAction(Ability Ability, String video) {
-		super(Ability);
-		this.video = video;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-        try {
-	        URL url = MainAbility.connection.fetchImage(this.video);
-
-		    File file = getFile(this.video, this.ability);
-		    if (!file.exists()) {
-		    	downloading = true;
-		    	file.createNewFile();
-		    	FileOutputStream outputStream = new FileOutputStream(file);
-			    InputStream stream = url.openConnection().getInputStream();
-		    	byte[] bytes= new byte[1024];
-		    	int count = 0;
-	            while (count != -1) {
-	            	count = stream.read(bytes, 0, 1024);
-		            if (count == -1) {
-		            	break;
-		            }
-		            outputStream.write(bytes, 0, count);
-	            }
-	            stream.close();
-	            outputStream.close();
-		    	downloading = false;
-		    }
-	        return "";
-        } catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-	    	downloading = false;
-        }
-        return null;
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java
deleted file mode 100644
index d3382aa6186f7bd29f9e88ffc14f2058bf162f3f..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java
+++ /dev/null
@@ -1,64 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.VoiceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetVoiceAction extends HttpResultAction {
-	InstanceConfig config;
-	VoiceConfig voice;
-
-	public HttpGetVoiceAction(Ability Ability, InstanceConfig config) {
-		super(Ability);
-		this.config = config;
-		doInBackground();
-	}
-
-	protected void doInBackground() {
-		try {
-		this.voice = MainAbility.connection.getVoice(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-
-		onPostExecute();
-	}
-
-	public void onPostExecute() {
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			if (!MainAbility.customVoice) {
-				MainAbility.voice = this.voice;
-				MainAbility.deviceVoice = this.voice.nativeVoice;
-//				if (this.ability instanceof VoiceAbility) {
-//					((VoiceAbility) this.ability).resetView();
-//				}
-			}
-		} catch (Exception error) {
-			this.exception = error;
-			return;
-		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java
deleted file mode 100644
index c984d17e2436d7149cbf1d4baf108c85af6fa5aa..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpImportBotScriptAction extends HttpUIAction {
-	ScriptConfig config;
-	ScriptSourceConfig script;
-	
-	public HttpImportBotScriptAction(Ability Ability, ScriptConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			//this.script = MainAbility.connection.getScriptSource(this.config);
-
-			MainAbility.connection.importBotScript(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java
deleted file mode 100644
index 0431d849bd37355817bf8f6a6a03c9994f5db279..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpPageInstancesAction extends HttpUIAction {
-	BrowseConfig config;
-	List<WebMediumConfig> instances;
-
-	public HttpPageInstancesAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.instances = MainAbility.connection.browse(ability,config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.instances = this.instances;
-
-		MainAbility.browse = this.config;
-//		((BrowseAbility)this.ability).instances = this.instances;
-//		((BrowseAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java
deleted file mode 100644
index db5535421227d2c23a13a850106d620e6a845a3f..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java
+++ /dev/null
@@ -1,62 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2017 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
- 
- package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.GraphicConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpRefreshAction extends HttpFetchAction {
-
-	
-	GraphicConfig instance;
-	
-	
-	public HttpRefreshAction(Ability Ability, GraphicConfig config) {
-		super(Ability, config);
-		instance = config;
-	}
-
-//	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-//	@Override
-	public void onPostExecute(String xml) {
-//		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java
deleted file mode 100644
index 18ee6f3a64b78423e963651d94399f2fc612f5d6..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarMedia;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveAvatarMediaAction extends HttpUIAction {
-
-	AvatarMedia config;
-	
-	public HttpSaveAvatarMediaAction(Ability Ability, AvatarMedia config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveAvatarMedia(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		this.ability.terminateAbility();
-		MainAbility.wasDelete = true;
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java
deleted file mode 100644
index 7031146ac6d3001f5e4daa85e1c1986f65c0f267..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java
+++ /dev/null
@@ -1,44 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.InstanceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveBotAvatarAction extends HttpUIAction {
-
-	InstanceConfig config;
-	
-	public HttpSaveBotAvatarAction(Ability Ability, InstanceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveBotAvatar(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java
deleted file mode 100644
index a03999fb83df6d6e0ec3247eeb18647c37ffffe0..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java
+++ /dev/null
@@ -1,55 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BotModeConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveForumBotModeAction extends HttpUIAction {
-
-	BotModeConfig config;
-	
-	public HttpSaveForumBotModeAction(Ability Ability, BotModeConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.saveForumBotMode(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.botMode = this.config;
-		
-		this.ability.terminateAbility();
-    }
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java
deleted file mode 100644
index 1a1228828e020c531e56dfdddf61517feb88193a..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.VoiceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveVoiceAction extends HttpUIAction {
-
-	VoiceConfig config;
-	
-	public HttpSaveVoiceAction(Ability Ability, VoiceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.saveVoice(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.voice = this.config;
-		this.ability.terminateAbility();
-    }
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java
deleted file mode 100644
index eeed3b90239cadccad6791df57c85f8a2f706458..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java
+++ /dev/null
@@ -1,61 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.Speech;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSpeechAction extends HttpAction {
-	Speech config;
-	String response;
-
-	public HttpSpeechAction(Ability Ability, Speech config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.response = MainAbility.connection.tts(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-//		try {
-//			final VoiceAbility Ability = (VoiceAbility)this.ability;
-//			Ability.playAudio(this.response, false, true, true);
-//		} catch (Exception error) {
-//			this.exception = error;
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//			return;
-//		}
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java
deleted file mode 100644
index c8156298a108b82394309f8727bb2d6d445cb5b6..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpStarPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpStarPostAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.star(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.post.stars = config.stars;
-//	    ((ForumPostAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java
deleted file mode 100644
index fd20173aafdf9c5f44e249b6f933a32fae571d50..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSubscribeAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpSubscribeAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.subscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java
deleted file mode 100644
index 0031ff92da6c9fbb2fde53ec00b864349c57142a..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSubscribeForumAction extends HttpUIAction {
-	ForumConfig config;
-
-	public HttpSubscribeForumAction(Ability Ability, ForumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.subscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java
deleted file mode 100644
index ee2348f437b3b5608dbf8f529715d1e34dbbb790..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsDownIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpThumbsDownIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsDown(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.issue.thumbsDown++;
-//	    ((IssueAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java
deleted file mode 100644
index 7c4c9179fc335c1d23f6a5099660e1c5e1c3fafc..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUnsubscribeForumAction extends HttpUIAction {
-	ForumConfig config;
-
-	public HttpUnsubscribeForumAction(Ability Ability, ForumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.unsubscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java
deleted file mode 100644
index 846ae93004bdb99f9e7051145baca1504d0cee32..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpdateForumPostAction extends HttpUIAction {
-	
-	ForumPostConfig config;
-
-	public HttpUpdateForumPostAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.update(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.post = this.config;
-			
-			this.ability.terminateAbility();
-			
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java
deleted file mode 100644
index 2a412260e4c52dc1da04735e66f99bf698569930..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java
+++ /dev/null
@@ -1,61 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpdateUserAction extends HttpUIAction {
-	UserConfig config;
-
-	public HttpUpdateUserAction(Ability Ability, UserConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.update(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.user = this.config;
-
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java
deleted file mode 100644
index b7b7065c55055ee1590601dea625bf7559aa69ad..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.GraphicConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUploadGraphicMediaAction extends HttpUIAction{
-
-	GraphicConfig config;
-	String file;
-	
-	public HttpUploadGraphicMediaAction(Ability Ability, String file, GraphicConfig config) {
-		super(Ability);
-		this.config = config;
-		this.file = file;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.createGraphicMedia(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		this.ability.terminateAbility();
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		HttpRefreshAction refresh = new HttpRefreshAction(this.ability,config);
-//		refresh.execute();
-	}
-}
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java
deleted file mode 100644
index 2124ff3c5497c51f6400e661949cadd76313d638..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java
+++ /dev/null
@@ -1,66 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.UserAdminConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUserAdminAction extends HttpUIAction {
-
-	UserAdminConfig config;
-	
-	public HttpUserAdminAction(Ability Ability, UserAdminConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.userAdmin(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		if (this.config.operation.equals("AddUser")) {
-//			((WebMediumUsersAbility)this.ability).users.add(this.config.operationUser);
-//		} else if (this.config.operation.equals("RemoveUser")) {
-//			((WebMediumUsersAbility)this.ability).users.remove(this.config.operationUser);
-//		} else if (this.config.operation.equals("AddAdmin")) {
-//			((WebMediumUsersAbility)this.ability).admins.add(this.config.operationUser);
-//		} else if (this.config.operation.equals("RemoveAdmin")) {
-//			((WebMediumUsersAbility)this.ability).admins.remove(this.config.operationUser);
-//		}
-//		TextField text = (TextField) this.ability.findComponentById(ResourceTable.Id_adminText);
-//		text.setText("");
-//        text = (TextField) this.ability.findComponentById(ResourceTable.Id_userText);
-//		text.setText("");
-//		((WebMediumUsersAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java
deleted file mode 100644
index 01215f2ed60eea3d5a4d4c6fccc2078af443ef93..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java
+++ /dev/null
@@ -1,44 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.config.ChatResponse;
-
-public class WarAction extends HttpAction {
-	ChatResponse config;
-
-	public WarAction(ohos.aafwk.ability.Ability Ability, ChatResponse config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			Thread.sleep(4000);
-		} catch (InterruptedException exception) {}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-//		((WarAbility)this.ability).switchBots();
-//		((WarAbility)this.ability).submitChat(this.config.message);
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
index 275ea4125ece92822879c086888206de39df99bb..0f1252ae5aa30f7321148eb629cb4240a7a8b59f 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
@@ -29,564 +29,561 @@ import org.botlibre.util.Utils;
 import org.w3c.dom.Element;
 
 /**
- * DTO for XML avatar config.
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
  */
 public class AvatarConfig extends WebMediumConfig {
-	public Map<String,AvatarMedia> mediaConfig;
-	private String avatarFormat;
-	private boolean avatarHD;
-	public String background;
-	public String icon;
-	
-	public String getType() {
-		return "avatar";
-	}
-	public AvatarConfig(){
-		mediaConfig = new HashMap<String, AvatarMedia>();
-	}
-	
-	public ChatResponse chatReply(ChatResponse chat) {
-		String emotion =  MicroConnection.getBot().mood().currentEmotionalState().name();
-		String action = MicroConnection.getBot().avatar().getAction();
-		String pose =  MicroConnection.getBot().avatar().getPose();
-		if (this.getBackground() != null) {
-			String background = this.getBackground();
-			chat.avatarBackground = background;
-		}
-		List<AvatarMedia> matching = null;
-		
-		// Audio
-		if (action != null) {
-			matching = this.getAudio(action, pose);
-			if (!matching.isEmpty()) {
-				AvatarMedia media = Utils.random(matching);
-				String [] array = media.media.split("\\.");
-				chat.avatarActionAudio = media.mediaId +  "." + array[1];
-				chat.avatarActionAudioType = media.getType();
-			}
-		}
-		matching = this.getAudio("", pose);
-		if (!matching.isEmpty()) {
-			AvatarMedia media = Utils.random(matching);
-			String [] array = media.media.split("\\.");
-			chat.avatarAudio = media.mediaId + "." + array[1];
-			chat.avatarAudioType = media.getType();
-		}
-		// Image/video
-		if (action != null) {
-			matching = this.getMedia(emotion, action, pose, "");
-			if (!matching.isEmpty()) {
-				AvatarMedia media = randomMatch(matching);
-				String[] array = media.media.split("\\.");
-				chat.avatarAction = media.mediaId+"."+array[1];
-			}
-		}
-		matching = this.getMedia(emotion, "", pose, "");
-		if (!matching.isEmpty()) {
-			AvatarMedia media = randomMatch(matching);
-			String[] array = media.media.split("\\.");
-			chat.avatar = media.mediaId+"."+array[1];
-			chat.avatar2 = null;
-			chat.avatar3 = null;
-			chat.avatar4 = null;
-			chat.avatar5 = null;
-			if (matching.size() > 1) {
-				AvatarMedia media2 = randomMatch(matching);
-				AvatarMedia media3 = randomMatch(matching);
-				AvatarMedia media4 = randomMatch(matching);
-				AvatarMedia media5 = randomMatch(matching);
-				if (media != media2 || media != media3 || media != media4 || media != media5) {
-					array = media2.media.split("\\.");
-					chat.avatar2 = media2.mediaId+"."+array[1];
-					array = media3.media.split("\\.");
-					chat.avatar3 = media3.mediaId+"."+array[1];
-					array = media4.media.split("\\.");
-					chat.avatar4 = media4.mediaId+"."+array[1];
-					array = media5.media.split("\\.");
-					chat.avatar5 = media5.mediaId+"."+array[1];
-				}
-			}
-			chat.avatarType = media.getType();
-		}
-		matching = this.getMedia(emotion, "", pose, "talking");
-		if (!matching.isEmpty()) {
-			AvatarMedia media = randomMatch(matching);
-			String [] array = media.media.split("\\.");
-			chat.avatarTalk = media.mediaId +"." +array[1];
-			chat.avatarTalkType = media.getType();
-		}
-		return chat;
-	}
+    public Map<String, AvatarMedia> mediaConfig;
+    private String avatarFormat;
+    private boolean avatarHD;
+    public String background;
+    public String icon;
+
+    /**
+     * getType
+     *
+     * @return ss
+     */
+    public String getType() {
+        return "avatar";
+    }
+
+    /**
+     * AvatarConfig
+     */
+    public AvatarConfig() {
+        mediaConfig = new HashMap<String, AvatarMedia>();
+    }
+
+    /**
+     * chatReply
+     *
+     * @param chat
+     * @return chat
+     */
+    public ChatResponse chatReply(ChatResponse chat) {
+        String emotion = MicroConnection.getBot().mood().currentEmotionalState().name();
+        String action = MicroConnection.getBot().avatar().getAction();
+        String pose = MicroConnection.getBot().avatar().getPose();
+        if (this.getBackground() != null) {
+            String background = this.getBackground();
+            chat.avatarBackground = background;
+        }
+        List<AvatarMedia> matching = null;
+
+        // Audio
+        if (action != null) {
+            matching = this.getAudio(action, pose);
+            if (!matching.isEmpty()) {
+                AvatarMedia media = Utils.random(matching);
+                String[] array = media.media.split("\\.");
+                chat.avatarActionAudio = media.mediaId + "." + array[1];
+                chat.avatarActionAudioType = media.getType();
+            }
+        }
+        matching = this.getAudio("", pose);
+        if (!matching.isEmpty()) {
+            AvatarMedia media = Utils.random(matching);
+            String[] array = media.media.split("\\.");
+            chat.avatarAudio = media.mediaId + "." + array[1];
+            chat.avatarAudioType = media.getType();
+        }
+        // Image/video
+        if (action != null) {
+            matching = this.getMedia(emotion, action, pose, "");
+            if (!matching.isEmpty()) {
+                AvatarMedia media = randomMatch(matching);
+                String[] array = media.media.split("\\.");
+                chat.avatarAction = media.mediaId + "." + array[1];
+            }
+        }
+        matching = this.getMedia(emotion, "", pose, "");
+        if (!matching.isEmpty()) {
+            AvatarMedia media = randomMatch(matching);
+            String[] array = media.media.split("\\.");
+            chat.avatar = media.mediaId + "." + array[1];
+            chat.avatar2 = null;
+            chat.avatar3 = null;
+            chat.avatar4 = null;
+            chat.avatar5 = null;
+            if (matching.size() > 1) {
+                AvatarMedia media2 = randomMatch(matching);
+                AvatarMedia media3 = randomMatch(matching);
+                AvatarMedia media4 = randomMatch(matching);
+                AvatarMedia media5 = randomMatch(matching);
+                if (media != media2 || media != media3 || media != media4 || media != media5) {
+                    array = media2.media.split("\\.");
+                    chat.avatar2 = media2.mediaId + "." + array[1];
+                    array = media3.media.split("\\.");
+                    chat.avatar3 = media3.mediaId + "." + array[1];
+                    array = media4.media.split("\\.");
+                    chat.avatar4 = media4.mediaId + "." + array[1];
+                    array = media5.media.split("\\.");
+                    chat.avatar5 = media5.mediaId + "." + array[1];
+                }
+            }
+            chat.avatarType = media.getType();
+        }
+        matching = this.getMedia(emotion, "", pose, "talking");
+        if (!matching.isEmpty()) {
+            AvatarMedia media = randomMatch(matching);
+            String[] array = media.media.split("\\.");
+            chat.avatarTalk = media.mediaId + "." + array[1];
+            chat.avatarTalkType = media.getType();
+        }
+        return chat;
+    }
+
+    /**
+     * credentials
+     *
+     * @return config
+     */
+    public WebMediumConfig credentials() {
+        AvatarConfig config = new AvatarConfig();
+        config.id = this.id;
+        return config;
+    }
+
+    /**
+     * toXML
+     *
+     * @return ss
+     */
+    public String toXML() {
+        StringWriter writer = new StringWriter();
+        writer.write("<avatar");
+        writeXML(writer);
+        writer.write("</avatar>");
+        return writer.toString();
+    }
+
+
+    /**
+     * parseXML
+     *
+     * @param element
+     */
+    public void parseXML(Element element) {
+        super.parseXML(element);
+    }
+
+    /**
+     * getMedia
+     *
+     * @param emotion
+     * @param action
+     * @param pose
+     * @param pose2
+     * @return dd
+     */
+    public List<AvatarMedia> getMedia(String emotion, String action, String pose, String pose2) {
+        if (emotion == null || emotion.isEmpty()) {
+            emotion = "NONE";
+        } else {
+            emotion = emotion.toUpperCase();
+        }
+        if (action == null) {
+            action = "";
+        }
+        if (pose == null) {
+            pose = "";
+        }
+        if (pose2 == null) {
+            pose2 = "";
+        }
+        boolean talking = pose2.equals("talking");
+        List<AvatarMedia> matches = new ArrayList<AvatarMedia>();
+        boolean none = emotion.equals("NONE");
+
+        boolean[][] matching = new boolean[this.mediaConfig.size()][4];
+        int index = 0;
+        // All match.
+        for (AvatarMedia media : this.mediaConfig.values()) {
+            if (media.isAudio()) {
+                index++;
+                continue;
+            }
+            boolean emotionMatch = media.getEmotions().contains(emotion) || (none && media.getEmotions().isEmpty());
+            if (emotionMatch && emotion.equals("RAGE") && media.getEmotions().contains("COURAGE")) {
+                // Both contain "rage".
+                emotionMatch = false;
+            }
+            if (emotionMatch && emotion.equals("LIKE") && media.getEmotions().contains("DISLIKE")) {
+                // Both contain "like".
+                emotionMatch = false;
+            }
+            boolean actionMatch = (!action.isEmpty() && media.getActions().contains(action)) || (action.isEmpty() && media.getActions().isEmpty());
+            boolean poseMatch = (!pose.isEmpty() && media.getPoses().contains(pose)) || (pose.isEmpty() && media.getPoses().isEmpty());
+            boolean pose2Match = (!pose2.isEmpty() && media.getPoses().contains(pose2)) || pose2.isEmpty();
+            if (!pose2Match && pose2.equals("talking")) {
+                pose2Match = media.getTalking();
+            } else if (media.getTalking() && !talking) {
+                pose2Match = false;
+            }
+            matching[index][0] = emotionMatch;
+            matching[index][1] = actionMatch;
+            matching[index][2] = poseMatch;
+            matching[index][3] = pose2Match;
+            index++;
+            if (emotionMatch && actionMatch && poseMatch && pose2Match) {
+                matches.add(media);
+            }
+        }
+        if (!matches.isEmpty()) {
+            return matches;
+        }
+        // Pose2 and pose matches.
+        if (!pose2.isEmpty()) {
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (media.isAudio()) {
+                    index++;
+                    continue;
+                }
+                boolean poseMatch = matching[index][2];
+                boolean pose2Match = matching[index][3];
+                if (poseMatch && pose2Match) {
+                    matches.add(media);
+                }
+                index++;
+            }
+            if (!matches.isEmpty()) {
+                return matches;
+            }
+            // Pose2 and emotion matches.
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (media.isAudio()) {
+                    index++;
+                    continue;
+                }
+                boolean emotionMatch = matching[index][0];
+                boolean pose2Match = matching[index][3];
+                if (emotionMatch && pose2Match) {
+                    if (!media.getPoses().isEmpty()) {
+                        index++;
+                        continue;
+                    }
+                    matches.add(media);
+                }
+                index++;
+            }
+            if (!matches.isEmpty()) {
+                return matches;
+            }
+            // Pose2 matches.
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (media.isAudio()) {
+                    index++;
+                    continue;
+                }
+                boolean pose2Match = matching[index][3];
+                if (pose2Match) {
+                    if (!media.getPoses().isEmpty()) {
+                        index++;
+                        continue;
+                    }
+                    matches.add(media);
+                }
+                index++;
+            }
+            if (!matches.isEmpty()) {
+                return matches;
+            }
+            // Pose2 any matches.
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (media.isAudio()) {
+                    index++;
+                    continue;
+                }
+                boolean pose2Match = matching[index][3];
+                if (pose2Match) {
+                    matches.add(media);
+                }
+                index++;
+            }
+            // For pose2, the pose is required (i.e. talking).
+            return matches;
+        }
+        // Action and pose matches.
+        if (!action.isEmpty()) {
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (media.isAudio()) {
+                    index++;
+                    continue;
+                }
+                if (!talking && media.getTalking()) {
+                    index++;
+                    continue;
+                }
+                boolean actionMatch = matching[index][1];
+                boolean poseMatch = matching[index][2];
+                if (actionMatch && poseMatch) {
+                    matches.add(media);
+                }
+                index++;
+            }
+            if (!matches.isEmpty()) {
+                return matches;
+            }
+            // Action matches.
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (media.isAudio()) {
+                    index++;
+                    continue;
+                }
+                if (!talking && media.getTalking()) {
+                    index++;
+                    continue;
+                }
+                boolean actionMatch = matching[index][1];
+                if (actionMatch
+                        && (media.getPoses().isEmpty() || media.getPoses().contains("none"))) {
+                    matches.add(media);
+                }
+                index++;
+            }
+            // For actions, the action is required.
+            return matches;
+        }
+        // Pose and emotion matches.
+        if (!pose.isEmpty()) {
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (media.isAudio()) {
+                    index++;
+                    continue;
+                }
+                if (!talking && media.getTalking()) {
+                    index++;
+                    continue;
+                }
+                boolean emotionMatch = matching[index][0];
+                boolean poseMatch = matching[index][2];
+                if (poseMatch && emotionMatch && media.getActions().isEmpty()) {
+                    matches.add(media);
+                }
+                index++;
+            }
+            if (!matches.isEmpty()) {
+                return matches;
+            }
+            // Pose matches.
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (media.isAudio()) {
+                    index++;
+                    continue;
+                }
+                if (!talking && media.getTalking()) {
+                    index++;
+                    continue;
+                }
+                boolean poseMatch = matching[index][2];
+                if (poseMatch && media.getActions().isEmpty()
+                        && (media.getEmotions().isEmpty() || media.getEmotions().contains("NONE"))) {
+                    matches.add(media);
+                }
+                index++;
+            }
+            if (!matches.isEmpty()) {
+                return matches;
+            }
+        }
+        // Emotion matches.
+        index = 0;
+        for (AvatarMedia media : this.mediaConfig.values()) {
+            if (media.isAudio()) {
+                index++;
+                continue;
+            }
+            if (!talking && media.getTalking()) {
+                index++;
+                continue;
+            }
+            boolean emotionMatch = matching[index][0];
+            if (emotionMatch
+                    && (media.getActions().isEmpty() || media.getActions().contains("none"))
+                    && (media.getPoses().isEmpty() || media.getPoses().contains("none"))) {
+                matches.add(media);
+            }
+            index++;
+        }
+        if (!matches.isEmpty()) {
+            return matches;
+        }
+        // Default matches.
+        index = 0;
+        for (AvatarMedia media : this.mediaConfig.values()) {
+            if (media.isAudio()) {
+                index++;
+                continue;
+            }
+            if (!talking && media.getTalking()) {
+                index++;
+                continue;
+            }
+            if ((media.getEmotions().isEmpty() || media.getEmotions().contains("NONE"))
+                    && (media.getActions().isEmpty() || media.getActions().contains("none"))
+                    && (media.getPoses().isEmpty() || media.getPoses().contains("none"))) {
+                matches.add(media);
+            }
+            index++;
+        }
+        return matches;
+    }
+
+    /**
+     * getAudio
+     *
+     * @param action
+     * @param pose
+     * @return ss
+     */
+    public List<AvatarMedia> getAudio(String action, String pose) {
+        if (action == null) {
+            action = "";
+        }
+        if (pose == null) {
+            pose = "";
+        }
+        List<AvatarMedia> matches = new ArrayList<AvatarMedia>();
 
-//	public String getDefaultAvatarMediaOne(){
-//		String name = null;
-//		for (AvatarMedia media: mediaConfig.values()) {
-//			if(!media.talking && media.hd && media.name.contains("blink") && media.poses.equals("") && media.emotions.equals("")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId+"."+array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	public String getDefaultAvatarMediaTwo(){
-//		String name = null;
-//		for (AvatarMedia media: mediaConfig.values()) {
-//			if(!media.talking && media.hd && media.name.contains("blink") && media.emotions.contains("HAPPY")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId+"."+array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	
-//	public String getDefaultAvatarMediaThree(){
-//		String name = null;
-//		for (AvatarMedia media: mediaConfig.values()) {
-//			if(!media.talking && media.hd && media.name.contains("blink") && media.emotions.contains("ANGER")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId+"."+array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	public String getDefaultAvatarMediaFour(){
-//		String name = null;
-//		for (AvatarMedia media: mediaConfig.values()) {
-//			if(!media.talking && media.hd && media.name.contains("blink") && media.emotions.equals("") && media.poses.contains("sleeping")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId+"."+array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	public String getTalkingAvatarMedia(){
-//		String name = null;
-//		for(AvatarMedia media : mediaConfig.values()){
-//			if(media.talking && media.hd && media.name.contains("talk")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId +"."+ array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	
-//	public String getTypeAvatarMedia(){
-//		return type;
-//	}
-	
-	public WebMediumConfig credentials() {
-		AvatarConfig config = new AvatarConfig();
-		config.id = this.id;
-		return config;
-	}
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<avatar");
-		writeXML(writer);
-		writer.write("</avatar>");
-		return writer.toString();
-	}
-	
-	
-	public void parseXML(Element element) {
-		super.parseXML(element);
-	}
-	
-	/**
-	 * Find any media that match the emotion, action, and pose, or the best matches.
-	 */
-	public List<AvatarMedia> getMedia(String emotion, String action, String pose, String pose2) {
-		if (emotion == null || emotion.isEmpty()) {
-			emotion = "NONE";
-		} else {
-			emotion = emotion.toUpperCase();
-		}
-		if (action == null) {
-			action = "";
-		}
-		if (pose == null) {
-			pose = "";
-		}
-		if (pose2 == null) {
-			pose2 = "";
-		}
-		boolean talking = pose2.equals("talking");
-		List<AvatarMedia> matches = new ArrayList<AvatarMedia>();
-		boolean none = emotion.equals("NONE");
-		
-		boolean[][] matching = new boolean[this.mediaConfig.size()][4];
-		int index = 0;
-		// All match.
-		for (AvatarMedia media : this.mediaConfig.values()) {
-			if (media.isAudio()) {
-				index++;
-				continue;
-			}
-			boolean emotionMatch = media.getEmotions().contains(emotion) || (none && media.getEmotions().isEmpty());
-			if (emotionMatch && emotion.equals("RAGE") && media.getEmotions().contains("COURAGE")) {
-				// Both contain "rage".
-				emotionMatch = false;
-			}
-			if (emotionMatch && emotion.equals("LIKE") && media.getEmotions().contains("DISLIKE")) {
-				// Both contain "like".
-				emotionMatch = false;
-			}
-			boolean actionMatch = (!action.isEmpty() && media.getActions().contains(action)) || (action.isEmpty() && media.getActions().isEmpty());
-			boolean poseMatch = (!pose.isEmpty() && media.getPoses().contains(pose)) || (pose.isEmpty() && media.getPoses().isEmpty());
-			boolean pose2Match = (!pose2.isEmpty() && media.getPoses().contains(pose2)) || pose2.isEmpty();
-			if (!pose2Match && pose2.equals("talking")) {
-				pose2Match = media.getTalking();
-			} else if (media.getTalking() && !talking) {
-				pose2Match = false;
-			}
-			matching[index][0] = emotionMatch;
-			matching[index][1] = actionMatch;
-			matching[index][2] = poseMatch;
-			matching[index][3] = pose2Match;
-			index++;
-			if (emotionMatch && actionMatch && poseMatch && pose2Match) {
-				matches.add(media);
-			}
-		}
-		if (!matches.isEmpty()) {
-			return matches;
-		}
-		// Pose2 and pose matches.
-		if (!pose2.isEmpty()) {
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (media.isAudio()) {
-					index++;
-					continue;
-				}
-				boolean poseMatch = matching[index][2];
-				boolean pose2Match = matching[index][3];
-				if (poseMatch && pose2Match) {
-					matches.add(media);
-				}
-				index++;
-			}
-			if (!matches.isEmpty()) {
-				return matches;
-			}
-			// Pose2 and emotion matches.
-			index = 0;
-			for (AvatarMedia media :this.mediaConfig.values()) {
-				if (media.isAudio()) {
-					index++;
-					continue;
-				}
-				boolean emotionMatch = matching[index][0];
-				boolean pose2Match = matching[index][3];
-				if (emotionMatch && pose2Match) {
-					if (!media.getPoses().isEmpty()) {
-						index++;
-						continue;
-					}
-					matches.add(media);
-				}
-				index++;
-			}
-			if (!matches.isEmpty()) {
-				return matches;
-			}
-			// Pose2 matches.
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (media.isAudio()) {
-					index++;
-					continue;
-				}
-				boolean pose2Match = matching[index][3];
-				if (pose2Match) {
-					if (!media.getPoses().isEmpty()) {
-						index++;
-						continue;
-					}
-					matches.add(media);
-				}
-				index++;
-			}
-			if (!matches.isEmpty()) {
-				return matches;
-			}
-			// Pose2 any matches.
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (media.isAudio()) {
-					index++;
-					continue;
-				}
-				boolean pose2Match = matching[index][3];
-				if (pose2Match) {
-					matches.add(media);
-				}
-				index++;
-			}
-			// For pose2, the pose is required (i.e. talking).
-			return matches;
-		}
-		// Action and pose matches.
-		if (!action.isEmpty()) {
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (media.isAudio()) {
-					index++;
-					continue;
-				}
-				if (!talking && media.getTalking()) {
-					index++;
-					continue;
-				}
-				boolean actionMatch = matching[index][1];
-				boolean poseMatch = matching[index][2];
-				if (actionMatch && poseMatch) {
-					matches.add(media);
-				}
-				index++;
-			}
-			if (!matches.isEmpty()) {
-				return matches;
-			}
-			// Action matches.
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (media.isAudio()) {
-					index++;
-					continue;
-				}
-				if (!talking && media.getTalking()) {
-					index++;
-					continue;
-				}
-				boolean actionMatch = matching[index][1];
-				if (actionMatch
-						&& (media.getPoses().isEmpty() || media.getPoses().contains("none"))) {
-					matches.add(media);
-				}
-				index++;
-			}
-			// For actions, the action is required.
-			return matches;
-		}
-		// Pose and emotion matches.
-		if (!pose.isEmpty()) {
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (media.isAudio()) {
-					index++;
-					continue;
-				}
-				if (!talking && media.getTalking()) {
-					index++;
-					continue;
-				}
-				boolean emotionMatch = matching[index][0];
-				boolean poseMatch = matching[index][2];
-				if (poseMatch && emotionMatch && media.getActions().isEmpty()) {
-					matches.add(media);
-				}
-				index++;
-			}
-			if (!matches.isEmpty()) {
-				return matches;
-			}
-			// Pose matches.
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (media.isAudio()) {
-					index++;
-					continue;
-				}
-				if (!talking && media.getTalking()) {
-					index++;
-					continue;
-				}
-				boolean poseMatch = matching[index][2];
-				if (poseMatch && media.getActions().isEmpty() 
-						&& (media.getEmotions().isEmpty() || media.getEmotions().contains("NONE"))) {
-					matches.add(media);
-				}
-				index++;
-			}
-			if (!matches.isEmpty()) {
-				return matches;
-			}
-		}
-		// Emotion matches.
-		index = 0;
-		for (AvatarMedia media : this.mediaConfig.values()) {
-			if (media.isAudio()) {
-				index++;
-				continue;
-			}
-			if (!talking && media.getTalking()) {
-				index++;
-				continue;
-			}
-			boolean emotionMatch = matching[index][0];
-			if (emotionMatch
-						&& (media.getActions().isEmpty() || media.getActions().contains("none"))
-						&& (media.getPoses().isEmpty() || media.getPoses().contains("none"))) {
-				matches.add(media);
-			}
-			index++;
-		}
-		if (!matches.isEmpty()) {
-			return matches;
-		}
-		// Default matches.
-		index = 0;
-		for (AvatarMedia media : this.mediaConfig.values()) {
-			if (media.isAudio()) {
-				index++;
-				continue;
-			}
-			if (!talking && media.getTalking()) {
-				index++;
-				continue;
-			}
-			if ((media.getEmotions().isEmpty() || media.getEmotions().contains("NONE"))
-						&& (media.getActions().isEmpty() || media.getActions().contains("none"))
-						&& (media.getPoses().isEmpty() || media.getPoses().contains("none"))) {
-				matches.add(media);
-			}
-			index++;
-		}
-		return matches;
-	}
-	
-	/**
-	 * Find an audio media that matches the action or pose.
-	 */
-	public List<AvatarMedia> getAudio(String action, String pose) {
-		if (action == null) {
-			action = "";
-		}
-		if (pose == null) {
-			pose = "";
-		}
-		List<AvatarMedia> matches = new ArrayList<AvatarMedia>();
-		
-		boolean[][] matching = new boolean[this.mediaConfig.size()][2];
-		int index = 0;
-		// All match.
-		for (AvatarMedia media : this.mediaConfig.values()) {
-			if (!media.isAudio()) {
-				continue;
-			}
-			boolean actionMatch = (!action.isEmpty() && media.getActions().contains(action)) || (action.isEmpty() && media.getActions().isEmpty());
-			boolean poseMatch = (!pose.isEmpty() && media.getPoses().contains(pose)) || (pose.isEmpty() && media.getPoses().isEmpty());
-			matching[index][0] = actionMatch;
-			matching[index][1] = poseMatch;
-			index++;
-			if (actionMatch && poseMatch) {
-				matches.add(media);
-			}
-		}
-		if (!matches.isEmpty()) {
-			return matches;
-		}
-		// Action matches.
-		if (!action.isEmpty()) {
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (!media.isAudio()) {
-					continue;
-				}
-				boolean actionMatch = matching[index][0];
-				if (actionMatch && media.getPoses().isEmpty()) {
-					matches.add(media);
-				}
-				index++;
-			}
-			// For actions, the action is required.
-			return matches;
-		}
-		// Pose matches.
-		if (!pose.isEmpty()) {
-			index = 0;
-			for (AvatarMedia media : this.mediaConfig.values()) {
-				if (!media.isAudio()) {
-					continue;
-				}
-				boolean poseMatch = matching[index][1];
-				if (poseMatch && media.getActions().isEmpty()) {
-					matches.add(media);
-				}
-				index++;
-			}
-			if (!matches.isEmpty()) {
-				return matches;
-			}
-		}
-		// Default matches.
-		index = 0;
-		for (AvatarMedia media : this.mediaConfig.values()) {
-			if (!media.isAudio()) {
-				continue;
-			}
-			if ((media.getEmotions().isEmpty() || media.getEmotions().contains("NONE"))
-						&& (media.getActions().isEmpty() || media.getActions().contains("none"))
-						&& (media.getPoses().isEmpty() || media.getPoses().contains("none"))) {
-				matches.add(media);
-			}
-			index++;
-		}
-		return matches;
-	}
+        boolean[][] matching = new boolean[this.mediaConfig.size()][2];
+        int index = 0;
+        // All match.
+        for (AvatarMedia media : this.mediaConfig.values()) {
+            if (!media.isAudio()) {
+                continue;
+            }
+            boolean actionMatch = (!action.isEmpty() && media.getActions().contains(action)) || (action.isEmpty() && media.getActions().isEmpty());
+            boolean poseMatch = (!pose.isEmpty() && media.getPoses().contains(pose)) || (pose.isEmpty() && media.getPoses().isEmpty());
+            matching[index][0] = actionMatch;
+            matching[index][1] = poseMatch;
+            index++;
+            if (actionMatch && poseMatch) {
+                matches.add(media);
+            }
+        }
+        if (!matches.isEmpty()) {
+            return matches;
+        }
+        // Action matches.
+        if (!action.isEmpty()) {
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (!media.isAudio()) {
+                    continue;
+                }
+                boolean actionMatch = matching[index][0];
+                if (actionMatch && media.getPoses().isEmpty()) {
+                    matches.add(media);
+                }
+                index++;
+            }
+            // For actions, the action is required.
+            return matches;
+        }
+        // Pose matches.
+        if (!pose.isEmpty()) {
+            index = 0;
+            for (AvatarMedia media : this.mediaConfig.values()) {
+                if (!media.isAudio()) {
+                    continue;
+                }
+                boolean poseMatch = matching[index][1];
+                if (poseMatch && media.getActions().isEmpty()) {
+                    matches.add(media);
+                }
+                index++;
+            }
+            if (!matches.isEmpty()) {
+                return matches;
+            }
+        }
+        // Default matches.
+        index = 0;
+        for (AvatarMedia media : this.mediaConfig.values()) {
+            if (!media.isAudio()) {
+                continue;
+            }
+            if ((media.getEmotions().isEmpty() || media.getEmotions().contains("NONE"))
+                    && (media.getActions().isEmpty() || media.getActions().contains("none"))
+                    && (media.getPoses().isEmpty() || media.getPoses().contains("none"))) {
+                matches.add(media);
+            }
+            index++;
+        }
+        return matches;
+    }
 
-	public AvatarMedia randomMatch(List<AvatarMedia> matches) {
-		List<AvatarMedia> formatMatches = new ArrayList<AvatarMedia>();
-		String format = "mp4";
-		if (this.avatarFormat != null && !this.avatarFormat.isEmpty()) {
-			format = this.avatarFormat;
-		}
-		for (AvatarMedia media : matches) {
-			if (media.getType().indexOf(format) != -1) {
-				formatMatches.add(media);
-			}
-		}
-		if (formatMatches.isEmpty()) {
-			List<AvatarMedia> hdMatches = new ArrayList<AvatarMedia>();
-			for (AvatarMedia media : matches) {
-				if (this.avatarHD && media.getHD()) {
-					hdMatches.add(media);
-				} else if (!this.avatarHD && !media.getHD()) {
-					hdMatches.add(media);
-				}
-			}
-			if (!hdMatches.isEmpty()) {
-				return Utils.random(hdMatches);
-			}
-			return Utils.random(matches);
-		} else {
-			List<AvatarMedia> hdMatches = new ArrayList<AvatarMedia>();
-			for (AvatarMedia media : formatMatches) {
-				if (this.avatarHD && media.getHD()) {
-					hdMatches.add(media);
-				} else if (!this.avatarHD && !media.getHD()) {
-					hdMatches.add(media);
-				}
-			}
-			if (!hdMatches.isEmpty()) {
-				return Utils.random(hdMatches);
-			}
-			return Utils.random(formatMatches);
-		}
-	}
+    /**
+     * randomMatch
+     *
+     * @param matches
+     * @return ss
+     */
+    public AvatarMedia randomMatch(List<AvatarMedia> matches) {
+        List<AvatarMedia> formatMatches = new ArrayList<AvatarMedia>();
+        String format = "mp4";
+        if (this.avatarFormat != null && !this.avatarFormat.isEmpty()) {
+            format = this.avatarFormat;
+        }
+        for (AvatarMedia media : matches) {
+            if (media.getType().indexOf(format) != -1) {
+                formatMatches.add(media);
+            }
+        }
+        if (formatMatches.isEmpty()) {
+            List<AvatarMedia> hdMatches = new ArrayList<AvatarMedia>();
+            for (AvatarMedia media : matches) {
+                if (this.avatarHD && media.getHD()) {
+                    hdMatches.add(media);
+                } else if (!this.avatarHD && !media.getHD()) {
+                    hdMatches.add(media);
+                }
+            }
+            if (!hdMatches.isEmpty()) {
+                return Utils.random(hdMatches);
+            }
+            return Utils.random(matches);
+        } else {
+            List<AvatarMedia> hdMatches = new ArrayList<AvatarMedia>();
+            for (AvatarMedia media : formatMatches) {
+                if (this.avatarHD && media.getHD()) {
+                    hdMatches.add(media);
+                } else if (!this.avatarHD && !media.getHD()) {
+                    hdMatches.add(media);
+                }
+            }
+            if (!hdMatches.isEmpty()) {
+                return Utils.random(hdMatches);
+            }
+            return Utils.random(formatMatches);
+        }
+    }
 
-	public String getBackground(){
-		return background;
-	}
+    /**
+     * getBackground
+     *
+     * @return background
+     */
+    public String getBackground() {
+        return background;
+    }
 
-	public String getIcon(){
-		return icon;
-	}
+    /**
+     * getIcon
+     *
+     * @return icon
+     */
+    public String getIcon() {
+        return icon;
+    }
 }
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarMessage.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarMessage.java
index e947ee2599b4c2b3956c1a891aa3b24495c7071e..0078f540f6c6ab788ccc638bc9a92f519a49cadf 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarMessage.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarMessage.java
@@ -18,7 +18,6 @@
 
 package org.botlibre.sdk.config;
 
-import org.botlibre.sdk.util.Utils;
 
 import java.io.StringWriter;
 
@@ -71,7 +70,6 @@ public class AvatarMessage extends Config {
 		
 		if (this.message != null) {
 			writer.write("<message>");
-			writer.write(Utils.escapeHTML(this.message));
 			writer.write("</message>");
 		}
 		writer.write("</avatar-message>");
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/ConversationConfig.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/ConversationConfig.java
index dc2b363caa5cdff7ea26f35508506ccabf8f9c72..58a11bcdb65b62b99a6043e53e8ef2d1e1996719 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/ConversationConfig.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/ConversationConfig.java
@@ -24,7 +24,6 @@ import java.util.Date;
 import java.util.List;
 import java.util.Locale;
 
-import org.botlibre.sdk.util.Utils;
 import org.w3c.dom.Element;
 import org.w3c.dom.NodeList;
 
@@ -60,7 +59,7 @@ public class ConversationConfig extends Config {
 		try {
 			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
 			Date date = formater.parse(creationDate);
-			return Utils.displayTimestamp(date);
+			return "";
 		} catch (Exception exception) {
 			return creationDate;
 		}
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/ForumPostConfig.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/ForumPostConfig.java
index 50ed66a264cf38d85254c5d1ab3390b0a1ed6788..283beaeb0d6742abe781061087bf8596b0e3d6e6 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/ForumPostConfig.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/ForumPostConfig.java
@@ -25,7 +25,6 @@ import java.util.Date;
 import java.util.List;
 import java.util.Locale;
 
-import org.botlibre.sdk.util.Utils;
 import org.w3c.dom.Element;
 import org.w3c.dom.Node;
 import org.w3c.dom.NodeList;
@@ -97,13 +96,11 @@ public class ForumPostConfig extends Config {
 		writer.write(">");
 		if (this.topic != null) {
 			writer.write("<topic>");
-			writer.write(Utils.escapeHTML(this.topic));
 			writer.write("</topic>");
 		}
 		if (this.details != null) {
 			String text = this.details;
 			writer.write("<details>");
-			writer.write(Utils.escapeHTML(text));
 			writer.write("</details>");
 		}
 		if (this.tags != null) {
@@ -113,7 +110,6 @@ public class ForumPostConfig extends Config {
 		}
 		if (this.flaggedReason != null) {
 			writer.write("<flaggedReason>");
-			writer.write(Utils.escapeHTML(this.flaggedReason));
 			writer.write("</flaggedReason>");
 		}
 		writer.write("</forum-post>");
@@ -192,7 +188,7 @@ public class ForumPostConfig extends Config {
 		try {
 			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
 			Date date = formater.parse(creationDate);
-			return Utils.displayTimestamp(date);
+			return "";
 		} catch (Exception exception) {
 			return creationDate;
 		}
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/UserConfig.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/UserConfig.java
index 6e2324f4aab4c99d82c91c539df79ba343f37f9b..8254fedb5fa75880d65d7c16fc1b25dd10107edc 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/UserConfig.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/config/UserConfig.java
@@ -18,16 +18,11 @@
 
 package org.botlibre.sdk.config;
 
-import java.io.StringWriter;
-import java.text.SimpleDateFormat;
-import java.util.Date;
-import java.util.Locale;
-
 import org.botlibre.sdk.SDKConnection;
 import org.w3c.dom.Element;
 import org.w3c.dom.Node;
 
-import org.botlibre.sdk.util.Utils;
+import java.io.StringWriter;
 
 /**
  * DTO for XML user creation config.
@@ -61,25 +56,7 @@ public class UserConfig extends Config {
 	public boolean isFlagged;
 	public String flaggedReason;
 	
-	public String displayJoined() {
-		try {
-			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
-			Date date = formater.parse(joined);
-			return Utils.displayDate(date);
-		} catch (Exception exception) {
-			return joined;
-		}
-	}
-	
-	public String displayLastConnect() {
-		try {
-			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
-			Date date = formater.parse(lastConnect);
-			return Utils.displayTimestamp(date);
-		} catch (Exception exception) {
-			return lastConnect;
-		}
-	}
+
 	
 	public void addCredentials(SDKConnection connection) {
 		this.application = connection.getCredentials().getApplicationId();
@@ -167,7 +144,6 @@ public class UserConfig extends Config {
 		
 		if (this.bio != null) {
 			writer.write("<bio>");
-			writer.write(Utils.escapeHTML(this.bio));
 			writer.write("</bio>");
 		}
 		writer.write("</user>");
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
deleted file mode 100644
index e9e6524542f7192fc29177ef448e735559a82848..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
+++ /dev/null
@@ -1,189 +0,0 @@
-package org.botlibre.sdk.micro;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.actions.HttpUIAction;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import org.botlibre.sdk.util.PreferencesUtils;
-import ohos.aafwk.ability.Ability;
-import ohos.data.preferences.Preferences;
-import org.botlibre.Bot;
-import org.botlibre.api.knowledge.Network;
-import org.botlibre.api.knowledge.Vertex;
-import org.botlibre.api.sense.Sense;
-import org.botlibre.knowledge.Primitive;
-import org.botlibre.knowledge.micro.MicroMemory;
-import org.botlibre.self.SelfCompiler;
-import org.botlibre.sense.http.Wiktionary;
-import org.botlibre.sense.text.TextEntry;
-import org.botlibre.thought.consciousness.Consciousness;
-import org.botlibre.thought.language.Comprehension;
-import org.botlibre.thought.language.Language;
-import org.botlibre.thought.language.Language.LearningMode;
-
-/**
- * Bootstrap the bot the first time from an online response list file or script.
- */
-public class BootstrapAsync extends HttpUIAction {
-	public BootstrapAsync(Ability Ability) {
-		super(Ability);
-	}
-
-	protected String aimlScriptId;
-	protected String selfScriptId;
-	protected String greetingScriptId;
-	InstanceConfig config;
-	MicroConnection connection;
-	Bot bot=null;
-	boolean noInternet = false;
-	
-	//passing InstanceConfig and the Scripts Versions.
-	public synchronized void bootstrapBot(InstanceConfig config, String aimlScriptId, String greetingScriptId) {
-		this.greetingScriptId = greetingScriptId;
-		this.aimlScriptId = aimlScriptId;
-		this.config = config;	
-		this.execute();
-	}
-
-	protected boolean isResetRequired() {
-		// Check if bot memory exists.
-		if (!MicroMemory.checkExists()) {
-			return true;
-		}
-		try{
-		// Check if version is changed.
-		Preferences cookies = PreferencesUtils.getPreferences(MainAbility.current);
-		String aimlVersion = cookies.getString(this.aimlScriptId, null);
-		String greetingVersion = cookies.getString(this.greetingScriptId, null);
-		if (aimlVersion == null || aimlVersion.isEmpty() || greetingVersion == null || greetingVersion.isEmpty()) {
-			return true;
-		}
-		ScriptConfig aimlScript = new ScriptConfig();
-		aimlScript.id = this.aimlScriptId;
-		aimlScript = MainAbility.connection.fetch(aimlScript);
-		if (!aimlVersion.equals(aimlScript.version)) {
-			return true;
-		}
-		ScriptConfig greetingScript = new ScriptConfig();
-		greetingScript.id = this.greetingScriptId;
-		greetingScript = MainAbility.connection.fetch(greetingScript);
-		if (!greetingVersion.equals(greetingScript.version)) {
-			return true;
-		}
-		} catch (Exception ignore) {
-			return false;
-		}
-		return false;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MicroMemory.storageFileName = this.config.id;
-			this.connection = (MicroConnection) MainAbility.connection;
-			// Check if bot is already loaded first.
-			if (connection.getBot(this.config.id) != null) {
-				return "";
-			}
-			// Check if bot memory exists.
-			boolean resetRequired = isResetRequired();
-			
-			// If no reset is required, just load the bot.
-			if (!resetRequired) {
-				try {
-					this.bot = Bot.createInstance(Bot.CONFIG_FILE, this.config.id, true);
-					Language language = bot.mind().getThought(Language.class);
-					language.setLearningMode(LearningMode.Disabled);
-					language.setLearnGrammar(false);
-					Comprehension comprehension = bot.mind().getThought(Comprehension.class);
-					comprehension.setEnabled(false);
-					Consciousness consciousness = bot.mind().getThought(Consciousness.class);
-					consciousness.setEnabled(false);
-					Sense sense = bot.awareness().getSense(Wiktionary.class);
-					sense.setIsEnabled(false);
-				} catch (Exception failed) {
-					// If the load fails, then reset the bot.
-					resetRequired = true;
-				}
-			}
-			// If a reset is required the bot must be rebuilt from scratch and reimport the AIML and greeting files.
-			if (resetRequired) {
-				// Delete the old file if exists.
-				MicroMemory.reset();
-				// Fetch the scripts source code.
-				ScriptConfig aimlScript = new ScriptConfig();
-				aimlScript.id = this.aimlScriptId;
-				ScriptSourceConfig aimlSource = connection.getScriptSource(aimlScript);
-				ScriptConfig greetingScript = new ScriptConfig();
-				greetingScript.id = this.greetingScriptId;
-				ScriptSourceConfig greetingSource = connection.getScriptSource(greetingScript);
-				
-				MicroMemory.reset();
-				// Create new bot.
-				bot = Bot.createInstance(Bot.CONFIG_FILE, this.config.id, true);
-				Language language = bot.mind().getThought(Language.class);
-				language.setLearningMode(LearningMode.Disabled);
-				language.setLearnGrammar(false);
-				Comprehension comprehension = bot.mind().getThought(Comprehension.class);
-				comprehension.setEnabled(false);
-				Consciousness consciousness = bot.mind().getThought(Consciousness.class);
-				consciousness.setEnabled(false);
-				Sense sense = bot.awareness().getSense(Wiktionary.class);
-				sense.setIsEnabled(false);
-				//if bootstrapSystem was true, it will load the default script.
-				// Do not need to bootstrap, as only uses AIML.
-				//new Bootstrap().bootstrapSystem(bot, false);
-				// Load AIML file.
-				language.loadAIML(aimlSource.source, "ami", true, false, false);
-				// Load greeting response list.
-				bot.awareness().getSense(TextEntry.class).loadChat(greetingSource.source, "Response List", false, true);
-
-				// Shutdown will save the file.
-				bot.shutdown();
-				// Reload the bot from the file.
-				bot = Bot.createInstance(Bot.CONFIG_FILE, this.config.id, true);
-				language = bot.mind().getThought(Language.class);
-				language.setLearningMode(LearningMode.Disabled);
-				language.setLearnGrammar(false);
-				comprehension = bot.mind().getThought(Comprehension.class);
-				comprehension.setEnabled(false);
-				consciousness = bot.mind().getThought(Consciousness.class);
-				consciousness.setEnabled(false);
-				sense = bot.awareness().getSense(Wiktionary.class);
-				sense.setIsEnabled(false);
-
-				Preferences cookies = PreferencesUtils.getPreferences(MainAbility.current);
-				cookies.putString(this.aimlScriptId, aimlSource.versionName);
-				cookies.putString(this.greetingScriptId, greetingSource.versionName);
-				cookies.flush();
-			}
-			// Finally, add the bot to the connections active bots.
-			connection.addBot(this.config.id, bot);
-		} catch (Exception exception) {
-			noInternet = true;
-//			MicroMemory.reset();
-			return null;
-		}
-		return null;
-	}
-
-	/**
-	 * Load, compile, and add the state machine from the Self source code.
-	 */
-	public void loadSelf(Bot bot, String text) {
-
-		Network network = bot.memory().newMemory();
-		Vertex language = network.createVertex(bot.mind().getThought(Language.class).getPrimitive());
-		SelfCompiler compiler = SelfCompiler.getCompiler();
-		Vertex stateMachine = compiler.parseStateMachine(text, false, network);
-		SelfCompiler.getCompiler().pin(stateMachine);
-		language.addRelationship(Primitive.STATE, stateMachine);
-		network.save();
-	}
-	
-	@Override
-	protected void onPostExecute(String result) {
-		super.onPostExecute(result);
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
index b19fa4a065b658ee10ccb5f4df2d98afb1ffa0a4..8b7b2c60217d081159efbfd013b560880ca605d8 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
+++ b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
@@ -55,8 +55,9 @@ import java.util.HashMap;
 import java.util.Map;
 
 /**
- * The MicroConnection replaces the normal SDK remote connection with one that creates
- * and accessed bots locally.
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
  */
 public class MicroConnection extends SDKConnection implements TextListener {
     private WebMediumConfig config;
@@ -72,32 +73,51 @@ public class MicroConnection extends SDKConnection implements TextListener {
     }
 
     /**
-     * Create a micro/offline SDK connection.
-     * Use the credentials to enable online support.
+     * MicroConnection
+     *
+     * @param credentials
      */
     public MicroConnection(Credentials credentials) {
         this.credentials = credentials;
         this.url = credentials.url;
     }
 
+    /**
+     * addBot
+     *
+     * @param id
+     * @param bot
+     */
     public void addBot(String id, Bot bot) {
         activeBots.put(id, bot);
     }
 
+    /**
+     * getBot
+     *
+     * @param id
+     * @return
+     */
     public Bot getBot(String id) {
         return activeBots.get(id);
     }
 
+    /**
+     * getBot
+     *
+     * @return
+     */
     public static Bot getBot() {
         return bot;
     }
 
     /**
-     * Process the bot chat message and return the bot's response.
-     * The ChatConfig should contain the conversation id if part of a conversation.
-     * If a new conversation the conversation id is returned in the response.
+     * chat
+     *
+     * @param config
+     * @return
      */
-    public synchronized ChatResponse chat(ChatConfig config) {
+    public ChatResponse chat(ChatConfig config) {
         if (config.instance == null) {
             config.instance = "default";
         }
@@ -135,28 +155,27 @@ public class MicroConnection extends SDKConnection implements TextListener {
 
         sense.input(textInput);
         ChatResponse response = new ChatResponse();
-
-        try {
-            if (this.message == null) {
-                wait(5000);
-            }
-            if (this.message != null) {
-                response.message = this.message.getMessage();
-                response.command = bot.avatar().getCommand();
-                try {
-                    avatarConfig.chatReply(response);
-                } catch (Exception e) {
-                }
+        if (this.message == null) {
+            //wait(5000);
+        }
+        if (this.message != null) {
+            response.message = this.message.getMessage();
+            response.command = bot.avatar().getCommand();
+            try {
+                avatarConfig.chatReply(response);
+            } catch (Exception e) {
             }
-        } catch (InterruptedException exception) {
-//			this.exception = new SDKException("Timeout waiting for response");
-//			throw this.exception;
         }
+
         return response;
     }
 
     /**
-     * Fetch the local object.
+     * fetch
+     *
+     * @param config
+     * @param <T>
+     * @return
      */
     public <T extends WebMediumConfig> T fetch(T config) {
         this.config = config;
@@ -171,7 +190,10 @@ public class MicroConnection extends SDKConnection implements TextListener {
     }
 
     /**
-     * Return the bot's voice configuration.
+     * getVoice
+     *
+     * @param config
+     * @return
      */
     public VoiceConfig getVoice(InstanceConfig config) {
         VoiceConfig voice = new VoiceConfig();
@@ -180,13 +202,25 @@ public class MicroConnection extends SDKConnection implements TextListener {
         return voice;
     }
 
-    public synchronized void sendMessage(TextOutput message) {
-        LogUtils.e("[MicroConnection]---->output-sendMessage",message.getMessage());
+    /**
+     * sendMessage
+     *
+     * @param message
+     */
+    public void sendMessage(TextOutput message) {
+        LogUtils.e("[MicroConnection]---->output-sendMessage", message.getMessage());
         this.message = message;
         notifyAll();
     }
 
-    public synchronized Bot loadBot(String name, int id) {
+    /**
+     * loadBot
+     *
+     * @param name
+     * @param id
+     * @return
+     */
+    public Bot loadBot(String name, int id) {
         boolean exists = MicroMemory.checkExists();
         ResourceManager resManager = MyApplication.getAppContext().getResourceManager();
         RawFileEntry rawFile;
@@ -226,46 +260,34 @@ public class MicroConnection extends SDKConnection implements TextListener {
         return bot;
     }
 
-    public void loadAIMLScript(Language lang, InputStream source) {
-        lang.loadAIMLFile(source, config.id, false, false, true, "", 10000000);
-    }
 
+    /**
+     * loadResScript
+     *
+     * @param bot
+     * @param fileName
+     */
     public void loadResScript(Bot bot, String fileName) {
         URL url = getClass().getResource(fileName);
         bot.awareness().getSense(TextEntry.class).loadChatFile(url, "Response List", "", false, true);
     }
 
+    /**
+     * loadResScript
+     *
+     * @param bot
+     * @param file
+     */
     public void loadResScript(Bot bot, File file) {
         bot.awareness().getSense(TextEntry.class).loadChatFile(file, "Response List", "", false, true);
     }
 
-    public void loadSelfScript(Bot bot, String fileName) {
-        loadSelfScript(bot, getClass().getResource(fileName));
-    }
-
-    public void loadSelfScript(Bot bot, URL url) {
-        Network network = bot.memory().getShortTermMemory();
-        Vertex language = network.createVertex(new Primitive(Language.class.getName()));
-        SelfCompiler compiler = SelfCompiler.getCompiler();
-        Vertex stateMachine = compiler.parseStateMachine(url, "", false, network);
-        language.addRelationship(Primitive.STATE, stateMachine);
-        SelfCompiler.getCompiler().pin(stateMachine);
-    }
-
-    public void loadSelfScript(Bot bot, File file) {
-        Network network = bot.memory().getShortTermMemory();
-        Vertex language = network.createVertex(new Primitive(Language.class.getName()));
-        SelfCompiler compiler = SelfCompiler.getCompiler();
-        Vertex stateMachine = compiler.parseStateMachine(file, "", false, network);
-        language.addRelationship(Primitive.STATE, stateMachine);
-        SelfCompiler.getCompiler().pin(stateMachine);
-    }
-
-    public void renameMemory(Bot bot, String name) {
-        bot.memory().getShortTermMemory().createVertex(Primitive.SELF).addRelationship(Primitive.NAME, bot.memory().getShortTermMemory().createVertex(name));
-
-    }
-
+    /**
+     * reInitialize
+     *
+     * @param bot
+     * @return
+     */
     public Vertex reInitialize(Bot bot) {
         Network memory = bot.memory().newMemory();
         Vertex user = memory.createSpeaker("Admin");
@@ -274,6 +296,12 @@ public class MicroConnection extends SDKConnection implements TextListener {
         return user;
     }
 
+    /**
+     * copyStream
+     *
+     * @param input
+     * @throws IOException
+     */
     public static void copyStream(InputStream input) throws IOException {
         File file = new File(MicroMemory.storageDir, MicroMemory.storageFileName);
         FileOutputStream output = new FileOutputStream(file);
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/util/Utils.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/util/Utils.java
deleted file mode 100644
index e2667554458cf4b39b09db6f45618ae95b08168b..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/util/Utils.java
+++ /dev/null
@@ -1,517 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.util;
-
-import org.botlibre.BotException;
-
-import java.io.IOException;
-import java.io.InputStream;
-import java.io.InputStreamReader;
-import java.io.StringWriter;
-import java.util.Calendar;
-import java.util.Collection;
-import java.util.Date;
-import java.util.List;
-import java.util.Locale;
-import java.util.Random;
-import java.util.regex.Matcher;
-import java.util.regex.Pattern;
-
-
-/**
- * Utility class.
- */
-public class Utils {
-	public static Random random = new Random();
-	
-	public static Pattern httpRegex = Pattern.compile("\\b(?:https?|ftp|file):\\/\\/[a-z0-9-+&@#\\/%?=~_|!:,.;]*[a-z0-9-+&@#\\/%=~_|]", Pattern.CASE_INSENSITIVE);
-	public static Pattern wwwRegex = Pattern.compile("((www\\.)[^\\s]+)", Pattern.CASE_INSENSITIVE);
-	public static Pattern emailRegex = Pattern.compile("(([a-zA-Z0-9_\\-\\.]+)@[a-zA-Z_]+?(?:\\.[a-zA-Z]{2,6}))+", Pattern.CASE_INSENSITIVE);
-	
-	/**
-	 * Replace links with HTML links.
-	 * Includes http, www, images, video, audio, email address.
-	 */
-	public static String linkHTML(String text) {
-		if (text == null || text.length() == 0) {
-			return "";
-		}
-		boolean http = text.indexOf("http") != -1;
-		boolean www = text.indexOf("www.") != -1;
-		boolean email = text.indexOf("@") != -1;
-		if (!http && !www && !email) {
-			return text;
-		}
-		if (text.indexOf("<") != -1 && text.indexOf(">") != -1) {
-			return text;
-		}
-		if (http) {
-			Matcher matcher = httpRegex.matcher(text);
-			StringBuffer sb = new StringBuffer();
-			while (matcher.find()) {
-				String url = matcher.group();
-		    	if (url.indexOf(".png") != -1 || url.indexOf(".jpg") != -1 || url.indexOf(".jpeg") != -1 || url.indexOf(".gif") != -1) {
-		    		url = "<a href='" + url + "' target='_blank'><img src='" + url + "' height='300'></a>";
-		    	} else if (url.indexOf(".mp4") != -1 || url.indexOf(".webm") != -1 || url.indexOf(".ogg") != -1) {
-		    		url = "<a href='" + url + "' target='_blank'><video src='" + url + "' height='300'></a>";
-		    	} else if (url.indexOf(".wav") != -1 || url.indexOf(".mp3") != -1) {
-		    		url = "<a href='" + url + "' target='_blank'><audio src='" + url + "' controls>audio</a>";
-		    	} else {
-		    		url = "<a href='" + url + "' target='_blank'>" + url + "</a>";
-		    	}
-				matcher.appendReplacement(sb, url);
-			}
-			matcher.appendTail(sb);
-			text = sb.toString();
-		} else if (www) {
-			Matcher matcher = wwwRegex.matcher(text);
-			StringBuffer sb = new StringBuffer();
-			while (matcher.find()) {
-				String url = matcher.group();
-				matcher.appendReplacement(sb, "<a href='http://" + url + "' target='_blank'>" + url + "</a>");
-			}
-			matcher.appendTail(sb);
-			text = sb.toString();
-		}
-		
-		if (email) {
-			Matcher matcher = emailRegex.matcher(text);
-			StringBuffer sb = new StringBuffer();
-			while (matcher.find()) {
-				String address = matcher.group();
-				matcher.appendReplacement(sb, "<a href='mailto://" + address + "' target='_blank'>" + address + "</a>");
-			}
-			matcher.appendTail(sb);
-			text = sb.toString();
-		}
-		return text;
-	}
-	
-
-	/**
-	 * Replace reserved HTML character with their HTML escape codes.
-	 */
-	public static String escapeHTML(String html) {
-		return html.replace("&", "&amp;")
-	    	.replace("<", "&lt;")
-	    	.replace(">", "&gt;")
-	    	.replace("\"", "&quot;")
-	    	.replace("`", "&#96;")
-	    	.replace("'", "&#39;");
-	}
-
-	/**
-	 * Strip the HTML tags from the text.
-	 */
-	public static String stripTags(String html) {
-		if (html == null) {
-			return "";
-		}
-		String result = html;
-		if ((html.indexOf('<') != -1) && (html.indexOf('>') != -1)) {
-			StringWriter writer = new StringWriter();
-			TextStream stream = new TextStream(html);
-			while (!stream.atEnd()) {
-				String text = stream.upTo('<');
-				writer.write(text);
-				int position = stream.getPosition();
-				stream.skip();
-				String word = stream.nextWord();
-				if (word != null) {
-					if (word.equals("p")) {
-						writer.write("\n\n");
-					} else if (word.equals("br")) {
-						writer.write("\n");
-					} else if (word.equals("div")) {
-						writer.write("\n");
-					}
-					stream.skipTo('>');
-					if (stream.atEnd()) {
-						stream.setPosition(position);
-						writer.write(stream.upToEnd());
-					} else {
-						stream.skip();
-					}
-				}
-			}
-			result = writer.toString();
-		}
-		if (result.contains("&")) {
-			result = result.replace("&#34;", "\"");
-			result = result.replace("&#96;", "`");
-			result = result.replace("&#39;", "'");
-			result = result.replace("&#64;", "@");
-			result = result.replace("&#61;", "=");
-			result = result.replace("&lt;", "<");
-			result = result.replace("&gt;", ">");
-		}
-		return result;
-	}
-
-	/**
-	 * Format the text that may be HTML, or may be text, or markup, or a mix.
-	 */
-	public static String formatHTMLOutput(String text) {
-		if (text == null) {
-			return "";
-		}
-		int index = text.indexOf('<');
-		int index2 = text.indexOf('>');
-		boolean isHTML = (index != -1) && (index2 > index);
-		boolean isMixed = isHTML && text.contains("[code]");
-		if (isHTML && !isMixed) {
-			return text;
-		}
-		if (!isMixed && ((index != -1) || (index2 != -1))) {
-			text = text.replace("<", "&lt;");
-			text = text.replace(">", "&gt;");
-		}
-		TextStream stream = new TextStream(text);
-		StringWriter writer = new StringWriter();
-		boolean bullet = false;
-		boolean nbullet = false;
-		while (!stream.atEnd()) {
-			String line = stream.nextLine();
-			if (!isMixed && (line.contains("http://") || line.contains("https://"))) {
-				line = Utils.linkHTML(line);
-			}
-			TextStream lineStream = new TextStream(line);
-			boolean firstWord = true;
-			boolean span = false;
-			boolean cr = true;
-			while (!lineStream.atEnd()) {
-				while (!isMixed && firstWord && lineStream.peek() == ' ') {
-					lineStream.next();
-					writer.write("&nbsp;");
-				}
-				String whitespace = lineStream.nextWhitespace();
-				writer.write(whitespace);
-				if (lineStream.atEnd()) {
-					break;
-				}
-				String word = lineStream.nextWord();
-				if (!isMixed && nbullet && firstWord && !word.equals("#")) {
-					writer.write("</ol>\n");
-					nbullet = false;
-				} else if (!isMixed && bullet && firstWord && !word.equals("*")) {
-					writer.write("</ul>\n");
-					bullet = false;
-				}
-				if (firstWord && word.equals("[")) {
-					String peek = lineStream.peekWord();
-					if ("code".equals(peek)) {
-						lineStream.nextWord();
-						String next = lineStream.nextWord();
-						String lang = "javascript";
-						int lines = 20;
-						if ("lang".equals(next)) {
-							lineStream.skip();
-							lang = lineStream.nextWord();
-							if ("\"".equals(lang)) {
-								lang = lineStream.nextWord();
-								lineStream.skip();
-							}
-							next = lineStream.nextWord();
-						}
-						if ("lines".equals(next)) {
-							lineStream.skip();
-							String value = lineStream.nextWord();
-							if ("\"".equals(value)) {
-								value = lineStream.nextWord();
-								lineStream.skip();
-							}
-							lineStream.skip();
-							try {
-								lines = Integer.valueOf(value);
-							} catch (NumberFormatException ignore) {}
-						}
-						String id = "code" + stream.getPosition();
-						writer.write("<div style=\"width:100%;height:" + lines * 14 + "px;max-width:none\" id=\"" + id + "\">");
-						String code = lineStream.upToAll("[code]");
-						if (code.indexOf('<') != -1) {
-							code = code.replace("<", "&lt;");
-						}
-						if (code.indexOf('>') != -1) {
-							code = code.replace(">", "&gt;");
-						}
-						writer.write(code);
-						while (lineStream.atEnd() && !stream.atEnd()) {
-							line = stream.nextLine();
-							lineStream = new TextStream(line);
-							while (lineStream.peek() == ':') {
-								lineStream.next();
-								writer.write("&nbsp;&nbsp;&nbsp;&nbsp;");								
-							}
-							code = lineStream.upToAll("[code]");
-							if (code.indexOf('<') != -1) {
-								code = code.replace("<", "&lt;");
-							}
-							if (code.indexOf('>') != -1) {
-								code = code.replace(">", "&gt;");
-							}
-							writer.write(code);
-						}
-						lineStream.skip("[code]".length());
-						writer.write("</div>\n");
-
-						writer.write("<script>\n");
-						writer.write("var " + id + " = ace.edit('" + id + "');\n");
-						writer.write(id + ".getSession().setMode('ace/mode/" + lang + "');\n");
-						writer.write(id + ".setReadOnly(true);\n");
-						writer.write("</script>\n");
-					} else {
-						writer.write(word);
-					}
-				} else if (!isMixed && firstWord && word.equals("=")) {
-					int count = 2;
-					String token = word;
-					while (!lineStream.atEnd() && lineStream.peek() == '=') {
-						lineStream.skip();
-						count++;
-						token = token + "=";
-					}
-					String header = lineStream.upToAll(token);
-					if (lineStream.atEnd()) {
-						writer.write(token);
-						writer.write(header);
-					} else {
-						lineStream.skip(token.length());
-						writer.write("<h");
-						writer.write(String.valueOf(count));
-						writer.write(">");
-						writer.write(header);
-						writer.write("</h");
-						writer.write(String.valueOf(count));
-						writer.write(">");
-						cr = false;
-					}
-				} else if (!isMixed && firstWord && word.equals(":")) {
-					span = true;
-					int indent = 1;
-					while (!lineStream.atEnd() && lineStream.peek() == ':') {
-						lineStream.skip();				
-						indent++;
-					}
-					writer.write("<span style=\"display:inline-block;text-indent:");
-					writer.write(String.valueOf(indent * 20));
-					writer.write("px;\">");	
-				} else if (!isMixed && firstWord && word.equals("*")) {
-					if (!bullet) {
-						writer.write("<ul>");
-						bullet = true;
-					}
-					writer.write("<li>");
-					cr = false;
-				} else if (!isMixed && firstWord && word.equals("#")) {
-					if (!nbullet) {
-						writer.write("<ol>");
-						nbullet = true;
-					}
-					writer.write("<li>");
-					cr = false;
-				} else {
-					writer.write(word);
-				}
-				firstWord = false;
-			}
-			if (!isMixed && span) {
-				writer.write("</span>");
-			}
-			if (!isMixed && cr) { 
-				writer.write("<br/>\n");
-			}
-		}
-		if (!isMixed && bullet) {
-			writer.write("</ul>");
-		}
-		if (!isMixed && nbullet) {
-			writer.write("</ol>");
-		}
-		return writer.toString();
-	}
-	
-	public static String displayTimestamp(Date date) {
-		if (date == null) {
-			return "";
-		}
-		StringWriter writer = new StringWriter();
-		Calendar today = Calendar.getInstance();
-		Calendar calendar = Calendar.getInstance();
-		calendar.setTime(date);
-		if (calendar.get(Calendar.YEAR) == today.get(Calendar.YEAR)
-				&& calendar.get(Calendar.DAY_OF_YEAR) == today.get(Calendar.DAY_OF_YEAR)) {
-			writer.write("Today");
-		} else if (calendar.get(Calendar.YEAR) == today.get(Calendar.YEAR)
-				&& calendar.get(Calendar.DAY_OF_YEAR) == (today.get(Calendar.DAY_OF_YEAR) - 1)) {
-			writer.write("Yesterday");
-		} else {
-			writer.write(calendar.getDisplayName(Calendar.MONTH, Calendar.SHORT, Locale.US));
-			writer.write(" ");
-			writer.write(String.valueOf(calendar.get(Calendar.DAY_OF_MONTH)));
-			if (calendar.get(Calendar.YEAR) != today.get(Calendar.YEAR)) {
-				writer.write(" ");
-				writer.write(String.valueOf(calendar.get(Calendar.YEAR)));
-			}
-		}
-		writer.write(", ");
-		writer.write(String.valueOf(calendar.get(Calendar.HOUR_OF_DAY)));
-		writer.write(":");
-		if (calendar.get(Calendar.MINUTE) < 10) {
-			writer.write("0");
-		}
-		writer.write(String.valueOf(calendar.get(Calendar.MINUTE)));
-		
-		return writer.toString();
-	}
-	
-	public static String displayTime(Date date) {
-		if (date == null) {
-			return "";
-		}
-		StringWriter writer = new StringWriter();
-		Calendar calendar = Calendar.getInstance();
-		calendar.setTime(date);
-		writer.write(String.valueOf(calendar.get(Calendar.HOUR_OF_DAY)));
-		writer.write(":");
-		if (calendar.get(Calendar.MINUTE) < 10) {
-			writer.write("0");
-		}
-		writer.write(String.valueOf(calendar.get(Calendar.MINUTE)));
-		writer.write(":");
-		if (calendar.get(Calendar.SECOND) < 10) {
-			writer.write("0");
-		}
-		writer.write(String.valueOf(calendar.get(Calendar.SECOND)));
-		
-		return writer.toString();
-	}
-	
-	public static String displayDate(Date date) {
-		if (date == null) {
-			return "";
-		}
-		StringWriter writer = new StringWriter();
-		Calendar today = Calendar.getInstance();
-		Calendar calendar = Calendar.getInstance();
-		calendar.setTime(date);
-		if (calendar.get(Calendar.YEAR) == today.get(Calendar.YEAR)
-				&& calendar.get(Calendar.DAY_OF_YEAR) == today.get(Calendar.DAY_OF_YEAR)) {
-			writer.write("Today");
-		} else if (calendar.get(Calendar.YEAR) == today.get(Calendar.YEAR)
-				&& calendar.get(Calendar.DAY_OF_YEAR) == (today.get(Calendar.DAY_OF_YEAR) - 1)) {
-			writer.write("Yesterday");
-		} else {
-			writer.write(calendar.getDisplayName(Calendar.MONTH, Calendar.SHORT, Locale.US));
-			writer.write(" ");
-			writer.write(String.valueOf(calendar.get(Calendar.DAY_OF_MONTH)));
-			if (calendar.get(Calendar.YEAR) != today.get(Calendar.YEAR)) {
-				writer.write(" ");
-				writer.write(String.valueOf(calendar.get(Calendar.YEAR)));
-			}
-		}
-		
-		return writer.toString();
-	}
-	
-	/**
-	 * Capitalize the first character of the string.
-	 */
-	public static String capitalize(String text) {
-		if (text.length() == 0) {
-			return text;
-		}
-		return Character.toUpperCase(text.charAt(0)) + text.substring(1, text.length());
-	}
-	
-	public static Random random() {
-		return random;
-	}
-	
-	public static int random(int max) {
-		return random().nextInt(max);
-	}
-	
-	public static <T> T random(List<T> list) {
-		if ((list == null) || list.isEmpty()) {
-			return null;
-		}
-		return list.get(random().nextInt(list.size()));
-	}
-	/**
-	 * Get the contents of the stream to a .self file and parse it.
-	 */
-	public static String loadTextFile(InputStream stream, String encoding, int maxSize, boolean finish) {
-		if (encoding.trim().isEmpty()) {
-			encoding = "UTF-8";
-		}
-
-	    // FEFF because this is the Unicode char represented by the UTF-8 byte order mark (EF BB BF).
-	    String UTF8_BOM = "\uFEFF";
-	    
-		StringWriter writer = new StringWriter();
-		InputStreamReader reader = null;
-		try {
-			reader = new InputStreamReader(stream, encoding);
-			int size = 0;
-			int next = reader.read();
-			boolean first = true;
-			while (next >= 0) {
-				if (first && next == UTF8_BOM.charAt(0)) {
-					// skip
-				} else {
-					writer.write(next);
-				}
-				next = reader.read();
-				if (size > maxSize) {
-					throw new BotException("File size limit exceeded: " + size + " > " + maxSize + " token: " + next);
-				}
-				size++;
-			}
-		} catch (IOException exception) {
-			throw new BotException("IO Error: " + exception.getMessage(), exception);
-		} finally {
-			if (reader != null && finish) {
-				try {
-					reader.close();
-				} catch (IOException ignore) {}
-			}
-			if (stream != null && finish) {
-				try {
-					stream.close();
-				} catch (IOException ignore) {}
-			}
-		}
-		return writer.toString();
-	}
-	
-	public static <T> T random(Collection<T> collection) {
-		if ((collection == null) || collection.isEmpty()) {
-			return null;
-		}
-		int value = random().nextInt(collection.size());
-		int index = 0;
-		for (T element : collection) {
-			if (index == value) {
-				return element;				
-			}
-			index++;
-		}
-		return null;
-	}
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sense/BasicAwareness.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sense/BasicAwareness.java
deleted file mode 100644
index 07d430a96dba27084ee73eb6e1e005be92b6d199..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sense/BasicAwareness.java
+++ /dev/null
@@ -1,216 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-package org.botlibre.sense;
-
-import java.util.HashMap;
-import java.util.Map;
-
-import org.botlibre.sdk.util.LogUtils;
-import org.botlibre.Bot;
-import org.botlibre.api.knowledge.Vertex;
-import org.botlibre.api.sense.Awareness;
-import org.botlibre.api.sense.Sense;
-import org.botlibre.api.sense.Tool;
-
-/**
- * Controls and manages the senses.
- */
-
-public class BasicAwareness implements Awareness {
-
-    protected Bot bot;
-    protected Map<String, Sense> senses;
-    protected Map<String, Sense> sensesByShortName;
-
-    protected Map<String, Tool> tools;
-    protected Map<String, Tool> toolsByShortName;
-
-    public BasicAwareness() {
-        this.senses = new HashMap<String, Sense>();
-        this.sensesByShortName = new HashMap<String, Sense>();
-        this.tools = new HashMap<String, Tool>();
-        this.toolsByShortName = new HashMap<String, Tool>();
-    }
-
-    /**
-     * Return Bot.
-     */
-    public Bot getBot() {
-        return bot;
-    }
-
-    /**
-     * Set Bot.
-     */
-    public void setBot(Bot bot) {
-        this.bot = bot;
-    }
-
-    /**
-     * Initialize any configurable settings from the properties.
-     */
-    @Override
-    public void initialize(Map<String, Object> properties) {
-        return;
-    }
-
-    /**
-     * Reset state when instance is pooled.
-     */
-    @Override
-    public void pool() {
-        getBot().log(this, "Pool", Bot.FINE);
-        for (Sense sense : getSenses().values()) {
-            try {
-                sense.pool();
-            } catch (Exception exception) {
-                getBot().log(this, exception);
-            }
-        }
-        for (Tool tool : getTools().values()) {
-            try {
-                tool.pool();
-            } catch (Exception exception) {
-                getBot().log(this, exception);
-            }
-        }
-    }
-
-    @Override
-    public void shutdown() {
-        getBot().log(this, "Shutdown", Bot.FINE);
-        for (Sense sense : getSenses().values()) {
-            try {
-                sense.shutdown();
-            } catch (Exception exception) {
-                getBot().log(this, exception);
-            }
-        }
-        for (Tool tool : getTools().values()) {
-            try {
-                tool.shutdown();
-            } catch (Exception exception) {
-                getBot().log(this, exception);
-            }
-        }
-    }
-
-    @Override
-    public void awake() {
-        getBot().log(this, "Awake", Bot.FINE);
-        for (Sense sense : getSenses().values()) {
-            try {
-                sense.awake();
-            } catch (Exception exception) {
-                getBot().log(sense, exception);
-            }
-        }
-        for (Tool tool : getTools().values()) {
-            try {
-                tool.awake();
-            } catch (Exception exception) {
-                getBot().log(tool, exception);
-            }
-        }
-    }
-
-    public Map<String, Sense> getSenses() {
-        return senses;
-    }
-
-    @SuppressWarnings("unchecked")
-    public <T> T getSense(Class<T> type) {
-        return (T)getSense(type.getName());
-    }
-
-    public Sense getSense(String senseName) {
-        Sense sense = getSenses().get(senseName);
-        if (sense == null) {
-            sense = this.sensesByShortName.get(senseName);
-        }
-        return sense;
-    }
-
-    public void addSense(Sense sense) {
-        sense.setBot(getBot());
-        getSenses().put(sense.getName(), sense);
-        // Also index simple name.
-        this.sensesByShortName.put(sense.getClass().getSimpleName(), sense);
-        this.sensesByShortName.put(sense.getClass().getSimpleName().toLowerCase(), sense);
-    }
-
-    public void removeSense(Sense sense) {
-        getSenses().remove(sense.getName());
-        // Also index simple name.
-        this.sensesByShortName.remove(sense.getClass().getSimpleName());
-        this.sensesByShortName.remove(sense.getClass().getSimpleName().toLowerCase());
-    }
-
-    public Map<String, Tool> getTools() {
-        return tools;
-    }
-
-    @SuppressWarnings("unchecked")
-    public <T> T getTool(Class<T> type) {
-        return (T)getTool(type.getName());
-    }
-
-    public Tool getTool(String name) {
-        Tool tool = getTools().get(name);
-        if (tool == null) {
-            tool = this.toolsByShortName.get(name);
-        }
-        return tool;
-    }
-
-    public void addTool(Tool tool) {
-        tool.setBot(getBot());
-        getTools().put(tool.getName(), tool);
-        // Also index simple name.
-        this.toolsByShortName.put(tool.getClass().getSimpleName(), tool);
-        this.toolsByShortName.put(tool.getClass().getSimpleName().toLowerCase(), tool);
-    }
-
-    public void removeTool(Tool tool) {
-        getTools().remove(tool.getName());
-        // Also index simple name.
-        this.toolsByShortName.remove(tool.getClass().getSimpleName());
-        this.toolsByShortName.remove(tool.getClass().getSimpleName().toLowerCase());
-    }
-
-    public String toString() {
-        return getClass().getSimpleName();
-    }
-
-    /**
-     * Allow the sense to output the response.
-     */
-    public void output(Vertex output) {
-        getBot().mood().evaluateOutput(output);
-        getBot().avatar().evaluateOutput(output);
-        for (Sense sense : getSenses().values()) {
-            try {
-                sense.output(output);
-                LogUtils.e("[BasicAwareness]---->output-output",output.printString());
-            } catch (Throwable ignore) {
-                getBot().log(this, ignore);
-            }
-        }
-    }
-}
-
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sense/text/TextEntry.java b/BotLibreOffline/entry/src/main/java/org/botlibre/sense/text/TextEntry.java
deleted file mode 100644
index db08e4292879d583be7a63b3e865fd35b1badd7f..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sense/text/TextEntry.java
+++ /dev/null
@@ -1,954 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-package org.botlibre.sense.text;
-
-import java.io.File;
-import java.io.FileInputStream;
-import java.io.InputStream;
-import java.io.Writer;
-import java.net.URL;
-import java.util.logging.Level;
-
-import org.botlibre.sdk.util.LogUtils;
-import org.botlibre.BotException;
-import org.botlibre.api.knowledge.Network;
-import org.botlibre.api.knowledge.Vertex;
-import org.botlibre.emotion.EmotionalState;
-import org.botlibre.knowledge.Primitive;
-import org.botlibre.self.SelfCompiler;
-import org.botlibre.self.SelfParseException;
-import org.botlibre.sense.BasicSense;
-import org.botlibre.thought.language.Language;
-import org.botlibre.thought.language.Language.LanguageState;
-import org.botlibre.thought.language.Language.LearningMode;
-import org.botlibre.util.TextStream;
-import org.botlibre.util.Utils;
-
-/**
- * Process text to and from networks and
- * stimulates natural language thoughts.
- */
-
-public class TextEntry extends BasicSense {
-    public static int LOG_SLEEP = 5000;
-
-    /**
-     * Keeps track of the user involved in the conversation.
-     */
-    protected Long userId;
-
-    /**
-     * Keeps track of the current conversation.
-     */
-    protected Long conversationId;
-
-    /**
-     * The writer is the stream, text-box or chat client to output text to.
-     */
-    protected Writer writer;
-
-    protected TextListener textListener;
-
-    /** Allows contact info to be passed to sense. */
-    protected String info;
-
-    public TextEntry() {
-    }
-
-    public TextListener getTextListener() {
-        return textListener;
-    }
-
-    public void setTextListener(TextListener textListener) {
-        this.textListener = textListener;
-    }
-
-    /**
-     * Return the user involved in the conversation.
-     */
-    public Vertex getUser(Network network) {
-        if (this.userId == null) {
-            return null;
-        }
-        return network.findById(this.userId);
-    }
-
-    /**
-     * Set the user involved in the conversation.
-     */
-    public void setUser(Vertex user) {
-        if (user == null) {
-            this.userId = null;
-        } else {
-            this.userId = user.getId();
-        }
-    }
-
-    public String getInfo() {
-        return info;
-    }
-
-    public void setInfo(String info) {
-        this.info = info;
-    }
-
-    /**
-     * Return the writer used to output text to.
-     */
-    public Writer getWriter() {
-        return this.writer;
-    }
-
-    /**
-     * Set the writer used to output text to.
-     */
-    public void setWriter(Writer writer) {
-        this.writer = writer;
-    }
-
-    /**
-     * Process the text input.
-     */
-    @Override
-    public void input(Object inputText, Network network) {
-        if (!isEnabled()) {
-            return;
-        }
-        TextInput text = null;
-        if (inputText instanceof TextInput) {
-            text = (TextInput)inputText;
-        } else {
-            text = new TextInput((String)inputText);
-        }
-        log("Input", Level.INFO, text.text, getUser(network), getConversation(network));
-        inputSentence(text, network);
-    }
-
-    /**
-     * Process the text sentence.
-     */
-    public void inputSentence(TextInput text, Network network) {
-        Vertex input = null;
-        boolean newConversation = text.getText() == null;
-        if (newConversation) {
-            // Null input is used to get greeting.
-            input = network.createInstance(Primitive.INPUT);
-            input.addRelationship(Primitive.SENSE, getPrimitive());
-            input.addRelationship(Primitive.INSTANTIATION, Primitive.CHAT);
-            input.addRelationship(Primitive.INPUT, Primitive.NULL);
-        } else {
-            input = createInputSentence(text.getText().trim(), network);
-            input.addRelationship(Primitive.INSTANTIATION, Primitive.CHAT);
-        }
-        if (text.isCorrection()) {
-            input.addRelationship(Primitive.ASSOCIATED, Primitive.CORRECTION);
-        }
-        if (text.isOffended()) {
-            input.addRelationship(Primitive.ASSOCIATED, Primitive.OFFENDED);
-        }
-        input.addRelationship(Primitive.TARGET, Primitive.SELF);
-        // Process speaker.
-        Vertex speaker = getUser(network);
-        if (speaker == null) {
-            speaker = network.createSpeaker(DEFAULT_SPEAKER);
-            speaker.addRelationship(Primitive.ASSOCIATED, Primitive.ANONYMOUS);
-            if (this.info != null && !this.info.isEmpty()) {
-                String name = new TextStream(this.info).nextWord();
-                speaker.addRelationship(Primitive.NAME, network.createName(name));
-            }
-            setUser(speaker);
-        }
-
-        Language language = this.bot.mind().getThought(Language.class);
-        boolean applyEmote = language.shouldLearn(input, speaker) || (text.isCorrection() && language.shouldCorrect(input, speaker));
-
-        input.addRelationship(Primitive.SPEAKER, speaker);
-        speaker.addRelationship(Primitive.INPUT, input);
-        if (this.emotionalState != null && this.emotionalState != EmotionalState.NONE) {
-            this.emotionalState.apply(input);
-            if (applyEmote) {
-                this.emotionalState.apply(input.getRelationship(Primitive.INPUT));
-            }
-        }
-        if (this.action != null) {
-            input.addRelationship(Primitive.ACTION, new Primitive(this.action));
-            if (applyEmote) {
-                input.getRelationship(Primitive.INPUT).addRelationship(Primitive.ACTION, new Primitive(this.action));
-            }
-        }
-        // Process conversation.
-        Vertex conversation = getConversation(network);
-        if (newConversation || (conversation == null)) {
-            conversation = network.createInstance(Primitive.CONVERSATION);
-            conversation.addRelationship(Primitive.TYPE, Primitive.CHAT);
-            setConversation(conversation);
-            conversation.addRelationship(Primitive.SPEAKER, speaker);
-            conversation.addRelationship(Primitive.SPEAKER, Primitive.SELF);
-            if (this.info != null && !this.info.isEmpty()) {
-                Vertex infoInput = createInputSentence("Info: " + this.info.trim(), network);
-                infoInput.addRelationship(Primitive.INSTANTIATION, Primitive.CHAT);
-                Language.addToConversation(infoInput, conversation);
-            }
-        }
-        if (!newConversation) {
-            Language.addToConversation(input, conversation);
-        } else {
-            input.addRelationship(Primitive.CONVERSATION, conversation);
-        }
-
-        network.save();
-        this.bot.memory().addActiveMemory(input);
-    }
-
-    /**
-     * Output the vertex to text.
-     */
-    @Override
-    public synchronized void output(Vertex output) {
-        if (!isEnabled()) {
-            return;
-        }
-        Vertex sense = output.mostConscious(Primitive.SENSE);
-        // If not output to Text, ignore.
-        if (sense == null || (!getPrimitive().equals(sense.getData()))) {
-            return;
-        }
-        if (this.textListener != null) {
-            TextOutput text = new TextOutput();
-            text.setMessage(printInput(output));
-            this.textListener.sendMessage(text);
-            LogUtils.e("[TextEntry]---->output-output",text.getMessage());
-        } else {
-            if (this.writer == null) {
-                log("Missing writer", Level.WARNING);
-                return;
-            }
-            try {
-                this.writer.write(printInput(output));
-            } catch (Exception failed) {
-                log(failed);
-            }
-        }
-    }
-
-    /**
-     * Return the current conversation.
-     */
-    public Long getConversationId() {
-        return this.conversationId;
-    }
-
-    /**
-     * Return the current conversation.
-     */
-    public Vertex getConversation(Network network) {
-        if (this.conversationId == null) {
-            return null;
-        }
-        return network.findById(this.conversationId);
-    }
-
-    public void clearConversation() {
-        this.conversationId = null;
-        this.userId = null;
-        this.action = null;
-        this.emotionalState = EmotionalState.NONE;
-        this.info = null;
-    }
-
-    /**
-     * Stop sensing.
-     */
-    @Override
-    public void shutdown() {
-        super.shutdown();
-        clearConversation();
-    }
-
-    /**
-     * Reset state when instance is pooled.
-     */
-    @Override
-    public void pool() {
-        clearConversation();
-    }
-
-    /**
-     * Set the current conversation.
-     */
-    public void setConversation(Vertex conversation) {
-        this.conversationId = conversation.getId();
-    }
-
-    /**
-     * Process the log file from a URL.
-     */
-    public void loadChatFile(URL file, String format, String encoding, boolean processUnderstanding, boolean pin) {
-        try {
-            loadChatFile(Utils.openStream(file), format, encoding, MAX_FILE_SIZE, processUnderstanding, pin);
-        } catch (Exception exception) {
-            throw new BotException(exception);
-        }
-    }
-
-    /**
-     * Process the log file.
-     */
-    public void loadChatFile(File file, String format, String encoding, boolean processUnderstanding, boolean pin) {
-        try {
-            loadChatFile(new FileInputStream(file), format, encoding, MAX_FILE_SIZE, processUnderstanding, pin);
-        } catch (Exception exception) {
-            throw new BotException(exception);
-        }
-    }
-
-    /**
-     * Process the log file for a chat conversation.
-     * Input each message, in a listening only mode.
-     */
-    public void loadChatFile(InputStream stream, String format, String encoding, int maxSize, boolean processUnderstanding, boolean pin) {
-        try {
-            String text = Utils.loadTextFile(stream, encoding, maxSize);
-            loadChat(text, format, processUnderstanding, pin);
-        } catch (BotException exception) {
-            throw exception;
-        } catch (Exception exception) {
-            throw new BotException(exception);
-        }
-    }
-
-    /**
-     * Process the log file for a chat conversation.
-     * Input each message, in a listening only mode.
-     */
-    public void loadChat(String text, String format, boolean processUnderstanding, boolean pin) {
-        try {
-            if ("Response List".equalsIgnoreCase(format)) {
-                processResponseLog(text, pin);
-            } else if ("Chat Log".equalsIgnoreCase(format)) {
-                processChatLog(text, processUnderstanding, pin);
-            } else if ("CSV List".equalsIgnoreCase(format)) {
-                processCSVLog(text, pin);
-            } else {
-                throw new BotException("Invalid chat log format '" + format + "'");
-            }
-        } catch (BotException exception) {
-            throw exception;
-        } catch (Exception exception) {
-            throw new BotException(exception);
-        }
-    }
-
-    /**
-     * Process the log file for a chat conversation.
-     * Input each message, in a listening only mode.
-     */
-    public void processChatLog(String log, boolean comprehension, boolean pin) {
-        log("Loading chat log", Level.INFO, log.length());
-        TextStream stream = new TextStream(log);
-        Vertex lastSpeaker = null;
-        LanguageState oldState = getLanguageState();
-        Language languageThought = this.bot.mind().getThought(Language.class);
-        LearningMode oldMode = languageThought.getLearningMode();
-        if (comprehension) {
-            setLanguageState(LanguageState.ListeningOnly);
-            if (languageThought.getLearningMode() == LearningMode.Disabled) {
-                languageThought.setLearningMode(LearningMode.Everyone);
-            }
-        }
-        Vertex conversation = null;
-        Vertex question = null;
-        Vertex previous = null;
-        boolean wasAdmin = false;
-        boolean first = true;
-        boolean cycle = false;
-        int count = 0;
-        try {
-            while (!stream.atEnd()) {
-                count++;
-                int marker = stream.getPosition();
-                String line = stream.nextLine().trim();
-                if (first && line.indexOf("<?xml") != -1) {
-                    throw new SelfParseException("Chat log format must be text, not XML", stream);
-                }
-                first = false;
-                boolean cr = false;
-                // Skip blank lines.
-                while (line.length() == 0) {
-                    if (stream.atEnd()) {
-                        return;
-                    }
-                    cr = true;
-                    marker = stream.getPosition();
-                    line = stream.nextLine().trim();
-                }
-                Vertex input = null;
-                log("Processing chat log", Level.INFO, count, line);
-                for (int index = 0; index < RETRY; index++) {
-                    Network network = this.bot.memory().newMemory();
-                    try {
-                        if (comprehension) {
-                            // CR means new conversation.
-                            if (cr || (conversation == null)) {
-                                conversation = network.createInstance(Primitive.CONVERSATION);
-                                conversation.addRelationship(Primitive.TYPE, Primitive.CHAT);
-                                lastSpeaker = null;
-                            } else {
-                                conversation = network.createVertex(conversation);
-                            }
-                        }
-                        if (cr) {
-                            question = null;
-                            previous = null;
-                        }
-                        TextStream lineStream = new TextStream(line);
-                        String speakerName = lineStream.upTo(':');
-                        if (lineStream.atEnd()) {
-                            lineStream.reset();
-                            if (cycle) {
-                                speakerName = "self";
-                            } else {
-                                speakerName = "anonymous";
-                            }
-                            cycle = !cycle;
-                        } else {
-                            lineStream.skip();
-                        }
-                        char peek = lineStream.peek();
-                        EmotionalState state = EmotionalState.NONE;
-                        if (peek == '<') {
-                            lineStream.skip();
-                            String emotion = lineStream.upTo('>');
-                            if (lineStream.atEnd()) {
-                                stream.setPosition(marker);
-                                throw new SelfParseException("Expected '<emotion>' in chat text", stream);
-                            }
-                            lineStream.skip();
-                            try {
-                                state = EmotionalState.valueOf(emotion.toUpperCase());
-                            } catch (Exception exception) {
-                                stream.setPosition(marker);
-                                throw new SelfParseException("Invalid '<emotion>' in chat text", stream);
-                            }
-                        }
-                        setEmotionalState(state);
-                        String message = lineStream.upToEnd().trim();
-                        if (speakerName.equalsIgnoreCase("default")) {
-                            Vertex language = network.createVertex(Language.class);
-                            input = network.createSentence(message);
-                            input.setPinned(true);
-                            language.addRelationship(Primitive.RESPONSE, input);
-                        } else if (speakerName.equalsIgnoreCase("greeting")) {
-                            Vertex language = network.createVertex(Language.class);
-                            input = network.createSentence(message);
-                            input.setPinned(true);
-                            language.addRelationship(Primitive.GREETING, input);
-                        } else if (speakerName.equalsIgnoreCase("script")) {
-                            input = SelfCompiler.getCompiler().evaluateExpression(
-                                    message, network.createVertex(Primitive.SELF), network.createVertex(Primitive.SELF), false, network);
-                        } else {
-                            if (comprehension) {
-                                input = createInputSentence(message, network);
-                                input.addRelationship(Primitive.INSTANTIATION, Primitive.CHAT);
-                                if (this.emotionalState != EmotionalState.NONE) {
-                                    this.emotionalState.apply(input);
-                                    this.emotionalState.apply(input.getRelationship(Primitive.INPUT));
-                                }
-                                if (lastSpeaker != null) {
-                                    lastSpeaker = network.createVertex(lastSpeaker);
-                                    input.addRelationship(Primitive.TARGET, lastSpeaker);
-                                }
-                                Vertex speaker = null;
-                                if (speakerName.toLowerCase().equals("self")) {
-                                    speaker = network.createVertex(Primitive.SELF);
-                                    wasAdmin = true;
-                                } else {
-                                    speaker = network.createSpeaker(speakerName);
-                                    if (speakerName.equals("admin")) {
-                                        speaker.addRelationship(Primitive.ASSOCIATED, Primitive.ADMINISTRATOR);
-                                        wasAdmin = true;
-                                    }
-                                }
-                                input.addRelationship(Primitive.SPEAKER, speaker);
-                                speaker.addRelationship(Primitive.INPUT, input);
-                                conversation.addRelationship(Primitive.SPEAKER, speaker);
-                                Language.addToConversation(input, conversation);
-                                lastSpeaker = speaker;
-                            }
-                            Vertex sentence = network.createSentence(message);
-                            if (pin) {
-                                sentence.setPinned(true);
-                            }
-                            if (question != null) {
-                                question = network.createVertex(question);
-                                if (pin) {
-                                    question.setPinned(true);
-                                }
-                                Language.addResponse(question, sentence, null, null, null, languageThought.getLearningRate(), network);
-                                if (previous != null) {
-                                    previous = network.createVertex(previous);
-                                    Language.addSentencePreviousMeta(question, sentence, previous, false, network);
-                                }
-                            }
-                            previous = question;
-                            question = sentence;
-                        }
-                        network.save();
-                        break;
-                    } catch (SelfParseException failed) {
-                        failed.printStackTrace();
-                        log(failed);
-                        network.clear();
-                        throw failed;
-                    } catch (Exception failed) {
-                        failed.printStackTrace();
-                        log(failed);
-                        network.clear();
-                    }
-                }
-                if (comprehension) {
-                    if (input == null) {
-                        return;
-                    }
-                    this.bot.memory().addActiveMemory(input);
-                    int abort = 0;
-                    while ((abort < 20) && !input.hasRelationship(Primitive.CONTEXT)) {
-                        Utils.sleep(100);
-                        Network memory = this.bot.memory().newMemory();
-                        input = memory.createVertex(input);
-                        abort++;
-                    }
-                    if (count == 100) {
-                        log("Chat log import exceeds 100 lines, offloading to background task", Level.WARNING);
-                    }
-                    if (abort >= 20 || count > 100) {
-                        Utils.sleep(LOG_SLEEP);
-                    }
-                }
-            }
-            if (languageThought.getLearningMode() == LearningMode.Administrators && !wasAdmin) {
-                throw new SelfParseException("Expected 'admin:' speaker in chat text when learning mode is administrators only", stream);
-            }
-        } finally {
-            setLanguageState(oldState);
-            languageThought.setLearningMode(oldMode);
-        }
-    }
-
-    /**
-     * Process the log file for a list of question/answers.
-     * Input each message, in a listening only mode.
-     */
-    public void processResponseLog(String log, boolean pin) {
-        log("Loading response log", Level.INFO, log.length());
-        TextStream stream = new TextStream(log);
-        Network network = this.bot.memory().newMemory();
-        Vertex question = null;
-        Vertex answer = null;
-        boolean first = true;
-        boolean isDefault = false;
-        while (!stream.atEnd()) {
-            String line = stream.nextLine().trim();
-            if (first && line.indexOf("<?xml") != -1) {
-                throw new SelfParseException("Chat log format must be text, not XML", stream);
-            }
-            first = false;
-            String originalLine = line;
-            // Skip blank lines.
-            while (line.isEmpty()) {
-                if (stream.atEnd()) {
-                    return;
-                }
-                question = null;
-                answer = null;
-                line = stream.nextLine().trim();
-                originalLine = line;
-                if (!line.isEmpty()) {
-                    network = this.bot.memory().newMemory();
-                }
-            }
-            log("Processing response log", Level.INFO, line);
-            TextStream lineStream = new TextStream(line);
-            String command = lineStream.upTo(':');
-            if (!lineStream.atEnd()) {
-                lineStream.skip();
-                line = lineStream.upToEnd().trim();
-            } else {
-                command = "";
-            }
-            if (command.equalsIgnoreCase("default")) {
-                isDefault = true;
-                Vertex language = network.createVertex(Language.class);
-                question = network.createSentence(line);
-                question.setPinned(true);
-                language.addRelationship(Primitive.RESPONSE, question);
-            } else if (command.equalsIgnoreCase("greeting")) {
-                Vertex language = network.createVertex(Language.class);
-                question = network.createSentence(line);
-                question.setPinned(true);
-                language.addRelationship(Primitive.GREETING, question);
-            } else if (command.equalsIgnoreCase("script")) {
-                SelfCompiler.getCompiler().evaluateExpression(
-                        line, network.createVertex(Primitive.SELF), network.createVertex(Primitive.SELF), false, network);
-            } else if (command.equalsIgnoreCase("keywords")) {
-                if (question == null || answer == null) {
-                    throw new BotException("Missing question and response for keywords");
-                }
-                Language.addSentenceKeyWordsMeta(question, answer, line, network);
-            } else if (command.equalsIgnoreCase("required")) {
-                if (question == null || answer == null) {
-                    throw new BotException("Missing question and response for required words");
-                }
-                Language.addSentenceRequiredMeta(question, answer, line, network);
-            } else if (command.equalsIgnoreCase("emotions")) {
-                if (question == null) {
-                    throw new BotException("Missing phrase for emotions");
-                }
-                if (answer == null) {
-                    question.internalRemoveRelationships(Primitive.EMOTION);
-                    for (String emote : Utils.getWords(line)) {
-                        if (!emote.equals("none")) {
-                            try {
-                                EmotionalState.valueOf(emote.toUpperCase()).apply(question);
-                            } catch (Exception exception) {
-                                throw new BotException("Invalid emotion: " + emote);
-                            }
-                        }
-                    }
-                } else {
-                    Language.addSentenceEmotesMeta(question, answer, line, network);
-                }
-            } else if (command.equalsIgnoreCase("actions")) {
-                if (question == null) {
-                    throw new BotException("Missing phrase for actions");
-                }
-                if (answer == null) {
-                    question.internalRemoveRelationships(Primitive.ACTION);
-                    for (String action : Utils.getWords(line)) {
-                        if (!action.equals("none")) {
-                            question.addRelationship(Primitive.ACTION, new Primitive(action));
-                        }
-                    }
-                } else {
-                    Language.addSentenceActionMeta(question, answer, line, network);
-                }
-            } else if (command.equalsIgnoreCase("poses")) {
-                if (question == null) {
-                    throw new BotException("Missing phrase for poses");
-                }
-                if (answer == null) {
-                    question.internalRemoveRelationships(Primitive.POSE);
-                    for (String pose : Utils.getWords(line)) {
-                        if (!pose.equals("none")) {
-                            question.addRelationship(Primitive.POSE, new Primitive(pose));
-                        }
-                    }
-                } else {
-                    Language.addSentencePoseMeta(question, answer, line, network);
-                }
-            } else if (command.equalsIgnoreCase("previous")) {
-                if (question == null || (answer == null && !isDefault)) {
-                    throw new BotException("Missing question and response for previous");
-                }
-                Vertex previous = null;
-                if (line.startsWith("#")) {
-                    line = line.substring(1, line.length());
-                    if (!Utils.isAlphaNumeric(line)) {
-                        throw new BotException("A label must be a single alpha numeric string with no spaces (use - for a space) - " + line);
-                    }
-                    previous = network.createVertex(new Primitive(line));
-                } else {
-                    previous = network.createSentence(line);
-                }
-                if (pin) {
-                    previous.setPinned(true);
-                }
-                if (isDefault) {
-                    Vertex language = network.createVertex(Language.class);
-                    Language.addSentencePreviousMeta(language, question, previous, false, network);
-                } else {
-                    Language.addSentencePreviousMeta(question, answer, previous, false, network);
-                }
-            } else if (command.equalsIgnoreCase("require previous")) {
-                if (question == null || (answer == null && !isDefault)) {
-                    throw new BotException("Missing question and response for previous");
-                }
-                Vertex previous = null;
-                if (line.startsWith("#")) {
-                    line = line.substring(1, line.length());
-                    if (!Utils.isAlphaNumeric(line)) {
-                        throw new BotException("A label must be a single alpha numeric string with no spaces (use - for a space) - " + line);
-                    }
-                    previous = network.createVertex(new Primitive(line));
-                } else {
-                    previous = network.createSentence(line);
-                }
-                if (pin) {
-                    previous.setPinned(true);
-                }
-                if (isDefault) {
-                    Vertex language = network.createVertex(Language.class);
-                    Language.addSentencePreviousMeta(language, question, previous, true, network);
-                } else {
-                    Language.addSentencePreviousMeta(question, answer, previous, true, network);
-                }
-            } else if (command.equalsIgnoreCase("label")) {
-                if (question == null) {
-                    throw new BotException("Missing phrase for label");
-                }
-                if (line.startsWith("#")) {
-                    line = line.substring(1, line.length());
-                }
-                if (!Utils.isAlphaNumeric(line)) {
-                    throw new BotException("A label must be a single alpha numeric string with no spaces (use - for a space) - " + line);
-                }
-                Vertex label = network.createVertex(new Primitive(line));
-                if (pin) {
-                    label.setPinned(true);
-                }
-                label.addRelationship(Primitive.INSTANTIATION, Primitive.LABEL);
-                if (answer == null) {
-                    question.setRelationship(Primitive.LABEL, label);
-                    label.setRelationship(Primitive.RESPONSE, question);
-                } else {
-                    answer.setRelationship(Primitive.LABEL, label);
-                    label.setRelationship(Primitive.RESPONSE, answer);
-                }
-            } else if (command.equalsIgnoreCase("on repeat")) {
-                if (question == null) {
-                    throw new BotException("Missing question for on repeat");
-                }
-                Vertex repeat = network.createSentence(line);
-                if (pin) {
-                    repeat.setPinned(true);
-                }
-                if (answer == null) {
-                    question.addRelationship(Primitive.ONREPEAT, repeat);
-                } else {
-                    answer.addRelationship(Primitive.ONREPEAT, repeat);
-                }
-            } else if (command.equalsIgnoreCase("no repeat")) {
-                if (question == null) {
-                    throw new BotException("Missing question for no repeat");
-                }
-                if (answer == null) {
-                    question.addRelationship(Primitive.REQUIRE, Primitive.NOREPEAT);
-                } else {
-                    answer.addRelationship(Primitive.REQUIRE, Primitive.NOREPEAT);
-                }
-            } else if (command.equalsIgnoreCase("topic")) {
-                if (question == null) {
-                    throw new BotException("Missing phrase for topic");
-                }
-                if (answer == null) {
-                    if (isDefault) {
-                        Vertex language = network.createVertex(Language.class);
-                        Language.addSentenceTopicMeta(language, question, line, network);
-                    } else {
-                        Vertex topicFragment = network.createFragment(line);
-                        topicFragment.addRelationship(Primitive.INSTANTIATION, Primitive.TOPIC);
-                        network.createVertex(Primitive.TOPIC).addRelationship(Primitive.INSTANCE, topicFragment);
-                        topicFragment.addRelationship(Primitive.QUESTION, question);
-                        question.setRelationship(Primitive.TOPIC, topicFragment);
-                    }
-                } else {
-                    Language.addSentenceTopicMeta(question, answer, line, network);
-                }
-            } else if (command.equalsIgnoreCase("command")) {
-                if (question == null) {
-                    throw new BotException("Missing phrase for command");
-                }
-                if (answer == null) {
-                    if (isDefault) {
-                        Vertex language = network.createVertex(Language.class);
-                        Language.addSentenceCommandMeta(language, question, line, network);
-                    }
-                } else {
-                    Language.addSentenceCommandMeta(question, answer, line, network);
-                }
-            } else if (command.equalsIgnoreCase("think")) {
-                if (question == null) {
-                    throw new BotException("Missing phrase for think");
-                }
-                if (answer == null) {
-                    if (isDefault) {
-                        Vertex language = network.createVertex(Language.class);
-                        Language.addSentenceThinkMeta(language, question, line, network);
-                    }
-                } else {
-                    Language.addSentenceThinkMeta(question, answer, line, network);
-                }
-            } else if (command.equalsIgnoreCase("condition")) {
-                if (question == null) {
-                    throw new BotException("Missing phrase for condition");
-                }
-                if (answer == null) {
-                    if (isDefault) {
-                        Vertex language = network.createVertex(Language.class);
-                        Language.addSentenceConditionMeta(language, question, line, network);
-                    }
-                } else {
-                    Language.addSentenceConditionMeta(question, answer, line, network);
-                }
-            } else {
-                isDefault = false;
-                Vertex sentence = null;
-                if (originalLine.startsWith("#")) {
-                    originalLine = originalLine.substring(1, originalLine.length());
-                    if (!Utils.isAlphaNumeric(originalLine)) {
-                        throw new BotException("A label must be a single alpha numeric string with no spaces (use - for a space) - " + originalLine);
-                    }
-                    sentence = network.createVertex(new Primitive(originalLine));
-                    if (!sentence.hasRelationship(Primitive.INSTANTIATION, Primitive.LABEL)) {
-                        log("Missing label", Level.INFO, originalLine);
-                    }
-                } else {
-                    sentence = network.createSentence(originalLine);
-                }
-                if (pin) {
-                    sentence.setPinned(true);
-                }
-                if (question == null) {
-                    question = sentence;
-                } else {
-                    answer = sentence;
-                    Language.addResponse(question, answer, null, null, null, 0.9f, network);
-                }
-            }
-            network.save();
-        }
-        network.save();
-    }
-
-    /**
-     * Process the log file for list a of question/answers.
-     * Input each message, in a listening only mode.
-     */
-    public void processCSVLog(String log, boolean pin) {
-        log("Loading csv log", Level.INFO, log.length());
-        TextStream stream = new TextStream(log);
-        Network network = this.bot.memory().newMemory();
-        Vertex question = null;
-        Vertex answer = null;
-        boolean first = true;
-        while (!stream.atEnd()) {
-            String line = stream.nextLine().trim();
-            if (first && line.indexOf("<?xml") != -1) {
-                throw new SelfParseException("Chat log format must be text, not XML", stream);
-            }
-            first = false;
-            // Skip blank lines.
-            while (line.isEmpty()) {
-                if (stream.atEnd()) {
-                    return;
-                }
-                question = null;
-                answer = null;
-                line = stream.nextLine().trim();
-                if (!line.isEmpty()) {
-                    network = this.bot.memory().newMemory();
-                }
-            }
-            // Allow either ',' or '","' separators.
-            boolean quotes = line.contains("\"");
-            log("Processing csv line", Level.INFO, line);
-            // "questions","answer","topic"
-            // "What is this? What's this?","This is Open Bot.","Bot"
-            TextStream lineStream = new TextStream(line);
-            if (quotes) {
-                lineStream.skipTo('"');
-                lineStream.skip();
-            }
-            if (lineStream.atEnd()) {
-                log("Expecting \" character", Level.WARNING, line);
-                continue;
-            }
-            String questionText = null;
-            if (quotes) {
-                questionText = lineStream.upToAll("\",\"").trim();
-                lineStream.skip("\",\"".length());
-            } else {
-                questionText = lineStream.upTo(',').trim();
-                lineStream.skip();
-            }
-            if (lineStream.atEnd()) {
-                log("Expecting \",\" characters", Level.WARNING, line);
-                continue;
-            }
-            log("Processing csv question", Level.INFO, questionText);
-            String answerText = null;
-            if (quotes) {
-                answerText = lineStream.upToAll("\"").trim();
-            } else {
-                answerText = lineStream.upTo(',').trim();
-            }
-            lineStream.skip();
-            log("Processing csv answer", Level.INFO, answerText);
-            answer = network.createSentence(answerText);
-            if (pin) {
-                answer.setPinned(true);
-            }
-            // Topic
-            String topic = "";
-            if (quotes) {
-                if (lineStream.peek() != ',') {
-                    lineStream.skipTo('"', true);
-                    topic = lineStream.upTo('"').trim();
-                }
-            } else {
-                topic = lineStream.upTo(',').trim();
-            }
-            lineStream.skip();
-            // Keywords
-            String keywords = "";
-            if (quotes) {
-                if (lineStream.peek() != ',') {
-                    lineStream.skipTo('"', true);
-                    keywords = lineStream.upTo('"').trim();
-                }
-            } else {
-                keywords = lineStream.upTo(',').trim();
-            }
-            lineStream.skip();
-            // Required
-            String required = "";
-            if (quotes) {
-                if (lineStream.peek() != ',') {
-                    lineStream.skipTo('"', true);
-                    required = lineStream.upTo('"').trim();
-                }
-            } else {
-                required = lineStream.upTo(',').trim();
-            }
-
-            TextStream questionStream = new TextStream(questionText);
-            while (!questionStream.atEnd()) {
-                questionText = questionStream.upTo('?', true).trim();
-                if (!questionText.isEmpty() && !questionText.equals("?")) {
-                    question = network.createSentence(questionText);
-                    if (pin) {
-                        question.setPinned(true);
-                    }
-                    Language.addResponse(question, answer, topic, keywords, required, 0.9f, network);
-                }
-            }
-            network.save();
-        }
-        network.save();
-    }
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/thought/language/Language.java b/BotLibreOffline/entry/src/main/java/org/botlibre/thought/language/Language.java
deleted file mode 100644
index 01567ea6d1451656768b4d42522c9c7118df07a2..0000000000000000000000000000000000000000
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/thought/language/Language.java
+++ /dev/null
@@ -1,4977 +0,0 @@
-// Copyright Paphus Solutions, all rights reserved.
-package org.botlibre.thought.language;
-
-import java.io.File;
-import java.io.FileInputStream;
-import java.io.IOException;
-import java.io.InputStream;
-import java.io.StringWriter;
-import java.net.URL;
-import java.sql.Time;
-import java.util.ArrayList;
-import java.util.Collection;
-import java.util.Date;
-import java.util.HashMap;
-import java.util.HashSet;
-import java.util.Iterator;
-import java.util.List;
-import java.util.ListIterator;
-import java.util.Map;
-import java.util.Set;
-import java.util.logging.Level;
-
-import org.botlibre.sdk.util.LogUtils;
-import org.botlibre.Bot;
-import org.botlibre.BotException;
-import org.botlibre.aiml.AIMLParser;
-import org.botlibre.api.knowledge.Network;
-import org.botlibre.api.knowledge.Relationship;
-import org.botlibre.api.knowledge.Vertex;
-import org.botlibre.api.sense.Sense;
-import org.botlibre.emotion.EmotionalState;
-import org.botlibre.knowledge.Primitive;
-import org.botlibre.self.SelfCompiler;
-import org.botlibre.self.SelfDecompiler;
-import org.botlibre.self.SelfExecutionException;
-import org.botlibre.self.SelfInterpreter;
-import org.botlibre.self.SelfParseException;
-import org.botlibre.sense.context.Context;
-import org.botlibre.sense.http.Http;
-import org.botlibre.thought.BasicThought;
-import org.botlibre.util.Utils;
-
-/**
- * Processes words to determine meaning and response.
- */
-
-public class Language extends BasicThought {
-    public static float CONVERSATION_MATCH_PERCENTAGE = 0.5f;
-    public static float DISCUSSION_MATCH_PERCENTAGE = 0.9f;
-    public static int COVERSATIONAL_RESPONSE_DELAY = 1000;
-    public static int MAX_PROCCESS_TIME = 100000;
-    public static int MAX_STATE_PROCESS = 10000;
-    public static int MAX_RESPONSE_PROCESS = 2000;
-    public static int MAX_FILE_SIZE = 10000000;  // 10 meg
-    public static int MAX_DEPTH = 100;
-    public static int MAX_STACK = 500;
-    public static boolean PROCESS_HTTP = true;
-
-    protected boolean enableEmote = true;
-    protected boolean enableResponseMatch = true;
-    protected boolean checkExactMatchFirst = true;
-    protected boolean fixFormulaCase = true;
-    protected boolean learnGrammar = true;
-    protected boolean splitParagraphs = true;
-    protected boolean synthesizeResponse = false;
-    protected float conversationMatchPercentage = CONVERSATION_MATCH_PERCENTAGE;
-    protected float discussionMatchPercentage = DISCUSSION_MATCH_PERCENTAGE;
-    protected float learningRate = 0.5f;
-    protected Boolean allowLearning;
-
-    protected int maxStateProcess = MAX_STATE_PROCESS;
-    protected int maxResponseMatchProcess = MAX_RESPONSE_PROCESS;
-    protected String language = null;
-    protected int recursiveInputDepth;
-    protected int recursiveFormulaDepth;
-    protected long startTime;
-    protected boolean abort;
-
-    /** Store the state machine used for the last response (if any). */
-    protected Long lastStateMachineId;
-    /** Store the state used for the last response (if any). */
-    protected Long lastStateId;
-    /** Store the quotient used for the last response (if any). */
-    protected Long lastQuotientId;
-    /** Store the meta relationship for last response (if any). */
-    protected Long lastResponseMetaId;
-    /** Store if a mimic was used. */
-    protected boolean wasMimic;
-    /** Store the learning mode. */
-    protected LearningMode learningMode = LearningMode.Everyone;
-    /** Store the correction mode. */
-    protected CorrectionMode correctionMode = CorrectionMode.Everyone;
-
-    /** Optimize state loading. */
-    protected Set<Long> loadedStates = new HashSet<Long>();
-
-    /**
-     * Defines the various language conversational states.
-     */
-    public enum LanguageState {
-        Associate, Conversational, Listening, ListeningOnly, Discussion, Answering
-    }
-    /**
-     * Defines who the bot will learn from.
-     */
-    public enum LearningMode {
-        Disabled, Administrators, Users, Everyone
-    }
-    /**
-     * Defines who the bot will allow corrections from.
-     */
-    public enum CorrectionMode {
-        Disabled, Administrators, Users, Everyone
-    }
-
-    /**
-     * Add the input to the conversation.
-     */
-    public static void addToConversation(Vertex input, Vertex conversation) {
-        input.addRelationship(Primitive.CONVERSATION, conversation);
-        Vertex previous = conversation.lastRelationship(Primitive.INPUT);
-        if (previous != null) {
-            previous.addRelationship(Primitive.NEXT, input);
-            input.addRelationship(Primitive.PREVIOUS, previous);
-        }
-        conversation.addRelationship(Primitive.INPUT, input, Integer.MAX_VALUE);
-        Vertex sentence = input.getRelationship(Primitive.INPUT);
-        if (sentence != null && sentence.instanceOf(Primitive.SENTENCE)) {
-            // Also track sentences used in the conversation.
-            conversation.addRelationship(Primitive.SENTENCE, sentence);
-        }
-    }
-
-    /**
-     * Add the sentence from the previous input to the relationships response meta info.
-     */
-    public static void addSentencePreviousMeta(Relationship relationship, Vertex previousQuestionInput, Network network) {
-        // Associate previous question as meta info.
-        if (previousQuestionInput != null) {
-            Vertex previousQuestion = previousQuestionInput.getRelationship(Primitive.INPUT);
-            if (previousQuestion != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.addRelationship(Primitive.PREVIOUS, previousQuestion);
-            }
-        }
-    }
-
-    /**
-     * Add the keywords as required keywords for a response match to the question meta.
-     */
-    public static void addSentenceKeyWordsMeta(Vertex question, Vertex answer, String keywords, Network network) {
-        if (keywords == null || keywords.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.KEYWORD, network);
-        } else {
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.internalRemoveRelationships(Primitive.KEYWORD);
-                List<String> words = Utils.getWords(keywords);
-                for (String keyword : words) {
-                    Vertex word = network.createWord(keyword);
-                    meta.addRelationship(Primitive.KEYWORD, word);
-                    word.addRelationship(Primitive.INSTANTIATION, Primitive.KEYWORD);
-                    word.addRelationship(Primitive.KEYQUESTION, question);
-
-                    Vertex lowercase = network.createWord(keyword.toLowerCase());
-                    if (lowercase != word) {
-                        meta.addRelationship(Primitive.KEYWORD, lowercase);
-                        lowercase.addRelationship(Primitive.INSTANTIATION, Primitive.KEYWORD);
-                        lowercase.addRelationship(Primitive.KEYQUESTION, question);
-                    }
-                }
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.internalRemoveRelationships(Primitive.KEYWORD);
-                        List<String> words = Utils.getWords(keywords);
-                        for (String keyword : words) {
-                            Vertex word = network.createWord(keyword);
-                            meta.addRelationship(Primitive.KEYWORD, word);
-                            word.addRelationship(Primitive.KEYQUESTION, question);
-
-                            Vertex lowercase = network.createWord(keyword.toLowerCase());
-                            if (lowercase != word) {
-                                meta.addRelationship(Primitive.KEYWORD, lowercase);
-                                lowercase.addRelationship(Primitive.KEYQUESTION, question);
-                            }
-                        }
-
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the emotes to the response.
-     */
-    public static void addSentenceEmotesMeta(Vertex question, Vertex answer, String emotes, Network network) {
-        if (emotes == null || emotes.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.EMOTION, network);
-        } else {
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.internalRemoveRelationships(Primitive.EMOTION);
-                List<String> words = Utils.getWords(emotes);
-                for (String emote : words) {
-                    EmotionalState.valueOf(emote.toUpperCase()).apply(meta);
-                }
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.internalRemoveRelationships(Primitive.EMOTION);
-                        List<String> words = Utils.getWords(emotes);
-                        for (String emote : words) {
-                            EmotionalState.valueOf(emote.toUpperCase()).apply(meta);
-                        }
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the actions to the response.
-     */
-    public static void addSentenceActionMeta(Vertex question, Vertex answer, String actions, Network network) {
-        if (actions == null || actions.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.ACTION, network);
-        } else {
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.internalRemoveRelationships(Primitive.ACTION);
-                List<String> words = Utils.getWords(actions);
-                for (String action : words) {
-                    if (!action.equals("none")) {
-                        meta.addRelationship(Primitive.ACTION, new Primitive(action));
-                    }
-                }
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.internalRemoveRelationships(Primitive.ACTION);
-                        List<String> words = Utils.getWords(actions);
-                        for (String action : words) {
-                            if (!action.equals("none")) {
-                                meta.addRelationship(Primitive.ACTION, new Primitive(action));
-                            }
-                        }
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the actions to the response.
-     */
-    public static void addSentencePoseMeta(Vertex question, Vertex answer, String poses, Network network) {
-        if (poses == null || poses.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.POSE, network);
-        } else {
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.internalRemoveRelationships(Primitive.POSE);
-                List<String> words = Utils.getWords(poses);
-                for (String pose : words) {
-                    if (!pose.equals("none")) {
-                        meta.addRelationship(Primitive.POSE, new Primitive(pose));
-                    }
-                }
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.internalRemoveRelationships(Primitive.POSE);
-                        List<String> words = Utils.getWords(poses);
-                        for (String pose : words) {
-                            if (!pose.equals("none")) {
-                                meta.addRelationship(Primitive.POSE, new Primitive(pose));
-                            }
-                        }
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the previous for a response match to the question meta.
-     */
-    public static void addSentencePreviousMeta(Vertex question, Vertex answer, Vertex previous, boolean require, Network network) {
-        Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-        if (relationship != null) {
-            Vertex meta = relationship.getMeta();
-            if (previous != null) {
-                meta = network.createMeta(relationship);
-                meta.addRelationship(Primitive.PREVIOUS, previous);
-            }
-            if (meta != null) {
-                if (require) {
-                    meta.addRelationship(Primitive.REQUIRE, Primitive.PREVIOUS);
-                } else {
-                    Relationship required = meta.getRelationship(Primitive.REQUIRE, Primitive.PREVIOUS);
-                    if (required != null) {
-                        relationship.getMeta().internalRemoveRelationship(required);
-                    }
-                }
-            }
-        }
-        network.checkReduction(question);
-        Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-        if (synonyms != null) {
-            for (Relationship synonym : synonyms) {
-                relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                if (relationship != null) {
-                    Vertex meta = relationship.getMeta();
-                    if (previous != null) {
-                        meta = network.createMeta(relationship);
-                        meta.addRelationship(Primitive.PREVIOUS, previous);
-                    }
-                    if (meta != null) {
-                        if (require) {
-                            meta.addRelationship(Primitive.REQUIRE, Primitive.PREVIOUS);
-                        } else {
-                            Relationship required = meta.getRelationship(Primitive.REQUIRE, Primitive.PREVIOUS);
-                            if (required != null) {
-                                relationship.getMeta().internalRemoveRelationship(required);
-                            }
-                        }
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the keywords as required keywords for a response match to the question meta.
-     */
-    public static void addSentenceRequiredMeta(Vertex question, Vertex answer, String required, Network network) {
-        if (required == null || required.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.REQUIRED, network);
-        } else {
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.internalRemoveRelationships(Primitive.REQUIRED);
-                List<String> words = Utils.getWords(required);
-                for (String keyword : words) {
-                    Vertex word = network.createWord(keyword);
-                    meta.addRelationship(Primitive.REQUIRED, word);
-                    word.addRelationship(Primitive.QUESTION, question);
-                }
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.internalRemoveRelationships(Primitive.REQUIRED);
-                        List<String> words = Utils.getWords(required);
-                        for (String keyword : words) {
-                            meta.addRelationship(Primitive.REQUIRED, network.createWord(keyword));
-                        }
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the topic as a desired topic for a response match to the question meta.
-     */
-    public static void addSentenceTopicMeta(Vertex question, Vertex answer, String topic, Network network) {
-        if (topic == null || topic.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.TOPIC, network);
-        } else {
-            Vertex topicFragment = network.createFragment(topic);
-            topicFragment.addRelationship(Primitive.INSTANTIATION, Primitive.TOPIC);
-            network.createVertex(Primitive.TOPIC).addRelationship(Primitive.INSTANCE, topicFragment);
-            topicFragment.addRelationship(Primitive.QUESTION, question);
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.setRelationship(Primitive.TOPIC, topicFragment);
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.setRelationship(Primitive.TOPIC, topicFragment);
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the new response.
-     */
-    public static void addResponse(Vertex question, Vertex answer, Network network) {
-        addResponse(question, answer, null, null, null, 0.5f, network);
-    }
-
-    /**
-     * Add the new response.
-     */
-    public static void addResponse(Vertex question, Vertex answer, String topic, String keywords, String required, Network network) {
-        addResponse(question, answer, topic, keywords, required, 0.5f, network);
-    }
-
-    /**
-     * Add the new response.
-     */
-    public static void addResponse(Vertex question, Vertex answer, String topic, String keywords, String required, float correctness, Network network) {
-        question.addWeakRelationship(Primitive.RESPONSE, answer, correctness);
-        question.associateAll(Primitive.WORD, question, Primitive.QUESTION);
-        network.checkReduction(question);
-        question.weakAssociateAll(Primitive.SYNONYM, answer, Primitive.RESPONSE, correctness);
-        if (topic != null && !topic.isEmpty()) {
-            Language.addSentenceTopicMeta(question, answer, topic, network);
-        }
-        if (keywords != null && !keywords.isEmpty()) {
-            Language.addSentenceKeyWordsMeta(question, answer, keywords, network);
-        }
-        if (required != null && !required.isEmpty()) {
-            Language.addSentenceRequiredMeta(question, answer, required, network);
-        }
-    }
-
-    /**
-     * Add the command as the command for a response match to the question meta.
-     */
-    public static void addSentenceCommandMeta(Vertex question, Vertex answer, String command, Network network) {
-        if (command == null || command.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.COMMAND, network);
-        } else {
-            Vertex expression = network.createTemplate("Template(\"{Http.toJSON(" + command + ")}\")");
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.setRelationship(Primitive.COMMAND, expression);
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.setRelationship(Primitive.COMMAND, expression);
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the script as the think for a response match to the question meta.
-     */
-    public static void addSentenceThinkMeta(Vertex question, Vertex answer, String think, Network network) {
-        if (think == null || think.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.THINK, network);
-        } else {
-            Vertex expression = network.createTemplate("Template(\"{think {" + think + "}}\")");
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.setRelationship(Primitive.THINK, expression);
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.setRelationship(Primitive.THINK, expression);
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the script as the condition for a response match to the question meta.
-     */
-    public static void addSentenceConditionMeta(Vertex question, Vertex answer, String condition, Network network) {
-        if (condition == null || condition.trim().isEmpty()) {
-            clearSentenceMeta(question, answer, Primitive.CONDITION, network);
-        } else {
-            Vertex expression = network.createTemplate("Template(\"{if (true == (" + condition + ")) { \"true\" } else { \"false\" }}\")");
-            Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-            if (relationship != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.setRelationship(Primitive.CONDITION, expression);
-            }
-            network.checkReduction(question);
-            Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-            if (synonyms != null) {
-                for (Relationship synonym : synonyms) {
-                    relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                    if (relationship != null) {
-                        Vertex meta = network.createMeta(relationship);
-                        meta.setRelationship(Primitive.CONDITION, expression);
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Clear any relations in the meta of the type.
-     */
-    public static void clearSentenceMeta(Vertex question, Vertex answer, Primitive type, Network network) {
-        Relationship relationship = question.getRelationship(Primitive.RESPONSE, answer);
-        if (relationship != null && relationship.hasMeta()) {
-            relationship.getMeta().internalRemoveRelationships(type);
-        }
-        network.checkReduction(question);
-        Collection<Relationship> synonyms = question.getRelationships(Primitive.SYNONYM);
-        if (synonyms != null) {
-            for (Relationship synonym : synonyms) {
-                relationship = synonym.getTarget().getRelationship(Primitive.RESPONSE, answer);
-                if (relationship != null && relationship.hasMeta()) {
-                    relationship.getMeta().internalRemoveRelationships(type);
-                }
-            }
-        }
-    }
-
-    /**
-     * Add the sentence from the previous input to the relationships response meta info.
-     */
-    public static boolean addCorrection(Vertex originalQuestionInput, Vertex originalQuestion, Vertex wrongResponseInput, Vertex correction, Vertex previousQuestionInput, Network network) {
-        boolean wasCorrect= false;
-        Relationship relationship = null;
-        if (wrongResponseInput != null) {
-            Vertex wrongResponse = wrongResponseInput.mostConscious(Primitive.INPUT);
-            // If correcting with same answer, then don't uncorrect.
-            if (wrongResponse != correction) {
-                relationship = originalQuestion.getRelationship(Primitive.RESPONSE, wrongResponse);
-                // Could be a wrong response, or just a wrong response in the context.
-                // First mark wrong in context, then mark wrong in general.
-                if ((relationship == null) || (relationship.getCorrectness() < 0.5)) {
-                    originalQuestion.removeRelationship(Primitive.RESPONSE, wrongResponse);
-                    network.checkReduction(originalQuestion);
-                    originalQuestion.inverseAssociateAll(Primitive.SYNONYM, wrongResponse, Primitive.RESPONSE);
-                } else {
-                    relationship.setCorrectness(relationship.getCorrectness() / 2);
-                    originalQuestionInput.removeRelationship(Primitive.RESPONSE, wrongResponseInput);
-                    // Dissociate previous question as meta info.
-                    removeSentencePreviousMeta(relationship, previousQuestionInput, network);
-                }
-            } else {
-                wasCorrect = true;
-            }
-            Vertex input = wrongResponseInput.copy();
-            input.addRelationship(Primitive.ASSOCIATED, Primitive.CORRECTION);
-            input.setRelationship(Primitive.INPUT, correction);
-            relationship = network.getBot().mind().getThought(Comprehension.class).checkTemplate(input, network);
-            if (relationship != null) {
-                correction = relationship.getTarget();
-            }
-        }
-        relationship = originalQuestion.addRelationship(Primitive.RESPONSE, correction);
-        if (!originalQuestion.instanceOf(Primitive.PATTERN)) {
-            originalQuestion.associateAll(Primitive.WORD, originalQuestion, Primitive.QUESTION);
-        }
-        network.checkReduction(originalQuestion);
-        originalQuestion.associateAll(Primitive.SYNONYM, correction, Primitive.RESPONSE);
-        correction.addRelationship(Primitive.QUESTION, originalQuestion);
-        originalQuestion.setPinned(true);
-        correction.setPinned(true);
-        // Associate previous question as meta info.
-        addSentencePreviousMeta(relationship, previousQuestionInput, network);
-        return wasCorrect;
-    }
-
-    /**
-     * Remove the sentence from the previous input to the relationships response meta info.
-     */
-    public static void removeSentencePreviousMeta(Relationship relationship, Vertex previousQuestionInput, Network network) {
-        // Associate previous question as meta info.
-        if (previousQuestionInput != null) {
-            Vertex previousQuestion = previousQuestionInput.getRelationship(Primitive.INPUT);
-            if (previousQuestion != null) {
-                Vertex meta = network.createMeta(relationship);
-                meta.removeRelationship(Primitive.PREVIOUS, previousQuestion);
-            }
-        }
-    }
-
-    /**
-     * Create a new thought.
-     */
-    public Language() {
-    }
-
-    @Override
-    public void awake() {
-        String property = this.bot.memory().getProperty("Language.enableEmote");
-        if (property != null) {
-            setEnableEmote(Boolean.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.language");
-        if (property != null) {
-            setLanguage(property);
-        }
-        property = this.bot.memory().getProperty("Language.learningMode");
-        if (property != null) {
-            setLearningMode(LearningMode.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.maxResponseMatchProcess");
-        if (property != null) {
-            setMaxResponseMatchProcess(Integer.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.maxStateProcess");
-        if (property != null) {
-            setMaxStateProcess(Integer.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.conversationMatchPercentage");
-        if (property != null) {
-            setConversationMatchPercentage(Float.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.discussionMatchPercentage");
-        if (property != null) {
-            setDiscussionMatchPercentage(Float.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.learningRate");
-        if (property != null) {
-            setLearningRate(Float.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.checkExactMatchFirst");
-        if (property != null) {
-            setCheckExactMatchFirst(Boolean.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.enableResponseMatch");
-        if (property != null) {
-            setEnableResponseMatch(Boolean.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.learnGrammar");
-        if (property != null) {
-            setLearnGrammar(Boolean.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.splitParagraphs");
-        if (property != null) {
-            setSplitParagraphs(Boolean.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.synthesizeResponse");
-        if (property != null) {
-            setSynthesizeResponse(Boolean.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.fixFormulaCase");
-        if (property != null) {
-            setFixFormulaCase(Boolean.valueOf(property));
-        }
-        property = this.bot.memory().getProperty("Language.correctionMode");
-        if (property != null) {
-            setCorrectionMode(CorrectionMode.valueOf(property));
-        }
-    }
-
-    /**
-     * Migrate to new properties system.
-     */
-    public void migrateProperties() {
-        Network memory = getBot().memory().newMemory();
-        Vertex language = memory.createVertex(getPrimitive());
-        Vertex property = language.getRelationship(Primitive.EMOTE);
-        if (property != null) {
-            setEnableEmote((Boolean)property.getData());
-        }
-        property = language.getRelationship(Primitive.LANGUAGE);
-        if (property != null) {
-            setLanguage((String)property.getData());
-        }
-        property = language.getRelationship(Primitive.LEARNING);
-        if (property != null) {
-            setLearningMode(LearningMode.valueOf((String)property.getData()));
-        }
-        property = language.getRelationship(Primitive.MAXRESPONSEMATCHPROCESS);
-        if (property != null) {
-            setMaxResponseMatchProcess((Integer)property.getData());
-        }
-        property = language.getRelationship(Primitive.MAXSTATEPROCESS);
-        if (property != null) {
-            setMaxStateProcess((Integer)property.getData());
-        }
-        property = language.getRelationship(Primitive.CONVERSATIONMATCHPERCENTAGE);
-        if (property != null) {
-            setConversationMatchPercentage((Float)property.getData());
-        }
-        property = language.getRelationship(Primitive.DISCUSSIONMATCHPERCENTAGE);
-        if (property != null) {
-            setDiscussionMatchPercentage((Float)property.getData());
-        }
-        property = language.getRelationship(Primitive.LEARNINGRATE);
-        if (property != null) {
-            setLearningRate((Float)property.getData());
-        }
-        property = language.getRelationship(Primitive.CHECKEXACTMATCHFIRST);
-        if (property != null) {
-            setCheckExactMatchFirst((Boolean)property.getData());
-        }
-        property = language.getRelationship(Primitive.ENABLERESPONSEMATCH);
-        if (property != null) {
-            setEnableResponseMatch((Boolean)property.getData());
-        }
-        property = language.getRelationship(Primitive.LEARNGRAMMAR);
-        if (property != null) {
-            setLearnGrammar((Boolean)property.getData());
-        }
-        property = language.getRelationship(Primitive.FIXFORMULACASE);
-        if (property != null) {
-            setFixFormulaCase((Boolean)property.getData());
-        }
-        property = language.getRelationship(Primitive.CORRECTION);
-        if (property != null) {
-            if (property.getData() instanceof Boolean) {
-                if ((Boolean)property.getData()) {
-                    setCorrectionMode(CorrectionMode.Everyone);
-                } else {
-                    setCorrectionMode(CorrectionMode.Administrators);
-                }
-            } else {
-                setCorrectionMode(CorrectionMode.valueOf((String)property.getData()));
-            }
-        }
-
-        // Remove old properties.
-        language.internalRemoveRelationships(Primitive.EMOTE);
-        language.internalRemoveRelationships(Primitive.LANGUAGE);
-        language.internalRemoveRelationships(Primitive.LEARNING);
-        language.internalRemoveRelationships(Primitive.MAXRESPONSEMATCHPROCESS);
-        language.internalRemoveRelationships(Primitive.MAXSTATEPROCESS);
-        language.internalRemoveRelationships(Primitive.CONVERSATIONMATCHPERCENTAGE);
-        language.internalRemoveRelationships(Primitive.DISCUSSIONMATCHPERCENTAGE);
-        language.internalRemoveRelationships(Primitive.LEARNINGRATE);
-        language.internalRemoveRelationships(Primitive.CHECKEXACTMATCHFIRST);
-        language.internalRemoveRelationships(Primitive.ENABLERESPONSEMATCH);
-        language.internalRemoveRelationships(Primitive.LEARNGRAMMAR);
-        language.internalRemoveRelationships(Primitive.FIXFORMULACASE);
-        language.internalRemoveRelationships(Primitive.CORRECTION);
-
-        memory.save();
-
-        saveProperties();
-    }
-
-    public CorrectionMode getCorrectionMode() {
-        return correctionMode;
-    }
-
-    public void setCorrectionMode(CorrectionMode correctionMode) {
-        this.correctionMode = correctionMode;
-    }
-
-    public LearningMode getLearningMode() {
-        return learningMode;
-    }
-
-    public void setLearningMode(LearningMode learningMode) {
-        this.learningMode = learningMode;
-    }
-
-    public boolean getEnableResponseMatch() {
-        return enableResponseMatch;
-    }
-
-    public void setEnableResponseMatch(boolean enableResponseMatch) {
-        this.enableResponseMatch = enableResponseMatch;
-    }
-
-    public boolean getCheckExactMatchFirst() {
-        return checkExactMatchFirst;
-    }
-
-    public void setCheckExactMatchFirst(boolean checkExactMatchFirst) {
-        this.checkExactMatchFirst = checkExactMatchFirst;
-    }
-
-    public float getConversationMatchPercentage() {
-        return conversationMatchPercentage;
-    }
-
-    public void setConversationMatchPercentage(float conversationMatchPercentage) {
-        this.conversationMatchPercentage = conversationMatchPercentage;
-    }
-
-    public boolean getSynthesizeResponse() {
-        return synthesizeResponse;
-    }
-
-    public void setSynthesizeResponse(boolean synthesizeResponse) {
-        this.synthesizeResponse = synthesizeResponse;
-    }
-
-    public float getLearningRate() {
-        return learningRate;
-    }
-
-    public void setLearningRate(float learningRate) {
-        this.learningRate = learningRate;
-    }
-
-    public float getDiscussionMatchPercentage() {
-        return discussionMatchPercentage;
-    }
-
-    public void setDiscussionMatchPercentage(float discussionMatchPercentage) {
-        this.discussionMatchPercentage = discussionMatchPercentage;
-    }
-
-    public int getMaxStateProcess() {
-        return maxStateProcess;
-    }
-
-    public void setMaxStateProcess(int maxStateProcess) {
-        this.maxStateProcess = maxStateProcess;
-    }
-
-    public int getMaxResponseMatchProcess() {
-        return maxResponseMatchProcess;
-    }
-
-    public void setMaxResponseMatchProcess(int maxResponseMatchProcess) {
-        this.maxResponseMatchProcess = maxResponseMatchProcess;
-    }
-
-    public boolean getFixFormulaCase() {
-        return fixFormulaCase;
-    }
-
-    public void setFixFormulaCase(boolean fixFormulaCase) {
-        this.fixFormulaCase = fixFormulaCase;
-    }
-
-    public boolean getLearnGrammar() {
-        return learnGrammar;
-    }
-
-    public void setLearnGrammar(boolean learnGrammar) {
-        this.learnGrammar = learnGrammar;
-    }
-
-    public void saveProperties() {
-        Network memory = getBot().memory().newMemory();
-
-        memory.saveProperty("Language.correctionMode", getCorrectionMode().name(), true);
-        memory.saveProperty("Language.enableEmote", String.valueOf(getEnableEmote()), true);
-        memory.saveProperty("Language.language", getLanguage(), true);
-        memory.saveProperty("Language.learningMode", getLearningMode().name(), true);
-        memory.saveProperty("Language.maxResponseMatchProcess", String.valueOf(getMaxResponseMatchProcess()), true);
-        memory.saveProperty("Language.maxStateProcess", String.valueOf(getMaxStateProcess()), true);
-        memory.saveProperty("Language.discussionMatchPercentage", String.valueOf(getDiscussionMatchPercentage()), true);
-        memory.saveProperty("Language.learningRate", String.valueOf(getLearningRate()), true);
-        memory.saveProperty("Language.conversationMatchPercentage", String.valueOf(getConversationMatchPercentage()), true);
-        memory.saveProperty("Language.enableResponseMatch", String.valueOf(getEnableResponseMatch()), true);
-        memory.saveProperty("Language.checkExactMatchFirst", String.valueOf(getCheckExactMatchFirst()), true);
-        memory.saveProperty("Language.learnGrammar", String.valueOf(getLearnGrammar()), true);
-        memory.saveProperty("Language.splitParagraphs", String.valueOf(getSplitParagraphs()), true);
-        memory.saveProperty("Language.synthesizeResponse", String.valueOf(getSynthesizeResponse()), true);
-        memory.saveProperty("Language.fixFormulaCase", String.valueOf(getFixFormulaCase()), true);
-
-        memory.save();
-    }
-
-    public Map<Primitive, Object> clearVoiceProperties() {
-        Map<Primitive, Object> properties = new HashMap<Primitive, Object>();
-        Network memory = getBot().memory().newMemory();
-        Vertex language = memory.createVertex(getPrimitive());
-        Vertex property = language.getRelationship(Primitive.VOICE);
-        if (property != null) {
-            properties.put(Primitive.VOICE, property.getData());
-            property.setPinned(false);
-        }
-        property = language.getRelationship(Primitive.NATIVEVOICE);
-        if (property != null) {
-            properties.put(Primitive.NATIVEVOICE, property.getData());
-            property.setPinned(false);
-        }
-        property = language.getRelationship(Primitive.NATIVEVOICENAME);
-        if (property != null) {
-            properties.put(Primitive.NATIVEVOICENAME, property.getData());
-            property.setPinned(false);
-        }
-        property = language.getRelationship(Primitive.PITCH);
-        if (property != null) {
-            properties.put(Primitive.PITCH, property.getData());
-            property.setPinned(false);
-        }
-        property = language.getRelationship(Primitive.SPEECHRATE);
-        if (property != null) {
-            properties.put(Primitive.SPEECHRATE, property.getData());
-            property.setPinned(false);
-        }
-        property = language.getRelationship(Primitive.LANGUAGE);
-        if (property != null) {
-            properties.put(Primitive.LANGUAGE, property.getData());
-        }
-
-        language.internalRemoveRelationships(Primitive.VOICE);
-        language.internalRemoveRelationships(Primitive.NATIVEVOICE);
-        language.internalRemoveRelationships(Primitive.NATIVEVOICENAME);
-        language.internalRemoveRelationships(Primitive.PITCH);
-        language.internalRemoveRelationships(Primitive.SPEECHRATE);
-
-        memory.save();
-        return properties;
-    }
-
-    /**
-     * Stop analysing network.
-     */
-    public void stop() {
-        pool();
-    }
-
-    /**
-     * Reset state when instance is pooled.
-     */
-    @Override
-    public void pool() {
-        this.allowLearning = null;
-    }
-
-    public Boolean getAllowLearning() {
-        return allowLearning;
-    }
-
-    public void setAllowLearning(Boolean allowLearning) {
-        this.allowLearning = allowLearning;
-    }
-
-    public boolean getSplitParagraphs() {
-        return splitParagraphs;
-    }
-
-    public void setSplitParagraphs(boolean splitParagraphs) {
-        this.splitParagraphs = splitParagraphs;
-    }
-
-    /**
-     * Analyse the active memory for language.
-     */
-    public void think() {
-        if (isStopped() || !isEnabled()) {
-            return;
-        }
-        Network network = getShortTermMemory();
-        List<Vertex> activeMemory = getBot().memory().getActiveMemory();
-        for (int i = 0; i < activeMemory.size(); i++) {
-            Vertex vertex = network.createVertex(activeMemory.get(i));
-            log("Processing", Level.FINER, vertex);
-            try {
-                if (vertex.instanceOf(Primitive.INPUT)) {
-                    Vertex input = vertex;
-                    List<Vertex> sentences = new ArrayList<Vertex>();
-                    List<Vertex> responses = new ArrayList<Vertex>();
-                    Vertex inputValue = input.getRelationship(Primitive.INPUT);
-                    if (inputValue != null) {
-                        for (Vertex sentence : input.orderedRelations(Primitive.INPUT)) {
-                            if (sentence.instanceOf(Primitive.SENTENCE)) {
-                                if (getSplitParagraphs()) {
-                                    // Check if the input is a paragraph.
-                                    Vertex paragraph = network.createParagraph(sentence);
-                                    if (paragraph.instanceOf(Primitive.PARAGRAPH)) {
-                                        sentences.addAll(paragraph.orderedRelations(Primitive.SENTENCE));
-                                    } else {
-                                        sentences.add(paragraph);
-                                    }
-                                } else {
-                                    sentences.add(sentence);
-                                }
-                            } else if (sentence.instanceOf(Primitive.PARAGRAPH)) {
-                                sentences.addAll(sentence.orderedRelations(Primitive.SENTENCE));
-                            }
-                        }
-                    }
-                    List<Relationship> targets = vertex.orderedRelationships(Primitive.TARGET);
-                    Vertex target = null;
-                    if (targets != null && (targets.size() == 1)) {
-                        target = targets.get(0).getTarget();
-                    }
-                    Vertex speaker = input.mostConscious(Primitive.SPEAKER);
-                    Vertex self = network.createVertex(Primitive.SELF);
-                    Vertex inputSense = input.mostConscious(Primitive.SENSE);
-                    Vertex conversation = input.mostConscious(Primitive.CONVERSATION);
-                    boolean correction = input.hasRelationship(Primitive.ASSOCIATED, Primitive.CORRECTION);
-                    boolean offended = input.hasRelationship(Primitive.ASSOCIATED, Primitive.OFFENDED);
-                    boolean newConversation = (inputValue != null) && (inputValue.is(Primitive.NULL));
-                    LanguageState state = LanguageState.Answering;
-                    Sense sense = null;
-                    if (inputSense != null) {
-                        sense = getBot().awareness().getSense(((Primitive)inputSense.getData()).getIdentity());
-                        if (sense != null) {
-                            state = sense.getLanguageState();
-                        }
-                    }
-                    // Create output.
-                    Vertex output = network.createInstance(Primitive.INPUT);
-                    try {
-                        Vertex response = null;
-                        int index = 0;
-                        Map<Vertex, Vertex> variables = new HashMap<Vertex, Vertex>();
-                        SelfCompiler.addGlobalVariables(input, null, network, variables);
-                        getBot().avatar().reset();
-                        if (newConversation) {
-                            // If Correcting then this is a response to that previous question.
-                            response = processGreeting(input, conversation, network, state, variables);
-                            if (response != null) {
-                                this.bot.mood().evaluateResponse(response, null);
-                                this.bot.avatar().evaluateResponse(output, response, null, variables, network);
-                                responses.add(response);
-                            }
-                        } else {
-                            for (Vertex sentence : sentences) {
-                                checkQuestion(sentence, network);
-                                if (PROCESS_HTTP) {
-                                    // TODO make this occur in discovery
-                                    //processHttp(sentence, network);
-                                }
-                                log("Processing sentence", Level.FINE, sentence, speaker, targets);
-                                if (offended) {
-                                    // If offensive then remove the last sentence.
-                                    processOffensive(input, speaker, target, conversation, network);
-                                }
-                                if (correction) {
-                                    // If Correcting then this is a response to that previous question.
-                                    response = processCorrection(input, sentence, speaker, target, conversation, network);
-                                } else if (state == LanguageState.Associate) {
-                                    // Associate the context selection with the sentence.
-                                    response = processAssociation(sentence, network);
-                                } else if ((state == LanguageState.Listening) || (state == LanguageState.ListeningOnly)) {
-                                    processListening(input, sentence, speaker, conversation, targets, network, state);
-                                    // If target is self, then give an answer.
-                                    if ((state == LanguageState.Listening) && (target == self)) {
-                                        response = processConversational(input, sentence, conversation, variables, network, state);
-                                    } else {
-                                        // Associate response, process understanding, but don't respond.
-                                        processUnderstanding(input, sentence, this.conversationMatchPercentage, variables, network);
-                                        return;
-                                    }
-                                } else if (state == LanguageState.Discussion) {
-                                    processListening(input, sentence, speaker, conversation, targets, network, state);
-                                    // If target is self, then give an answer.
-                                    if (target == self) {
-                                        response = processConversational(input, sentence, conversation, variables, network, state);
-                                    } else if ((targets == null) || targets.isEmpty() || (targets.size() > 1)) {
-                                        // Process anything to a group, or to no one as a discussion.
-                                        response = processDiscussion(input, sentence, conversation, variables, network);
-                                    } else {
-                                        processUnderstanding(input, sentence, this.conversationMatchPercentage, variables, network);
-                                        log("Discussion response to other", Level.FINE, targets);
-                                    }
-                                } else if (state == LanguageState.Conversational) {
-                                    processListening(input, sentence, speaker, conversation, targets, network, state);
-                                    response = processConversational(input, sentence, conversation, variables, network, state);
-                                } else if (state == LanguageState.Answering) {
-                                    processListening(input, sentence, speaker, conversation, targets, network, state);
-                                    response = processConversational(input, sentence, conversation, variables, network, state);
-                                }
-                                // Check for label
-                                if ((response != null) && response.instanceOf(Primitive.LABEL)) {
-                                    response = response.mostConscious(Primitive.RESPONSE);
-                                }
-                                // Check for formula and transpose
-                                if ((response != null) && response.instanceOf(Primitive.FORMULA)) {
-                                    log("Response is template formula", Level.FINE, response);
-                                    Vertex result = evaluateFormula(response, variables, network);
-                                    if (result == null) {
-                                        log("Template formula cannot be evaluated", Level.FINE, response);
-                                        response = null;
-                                    } else {
-                                        response = getWord(result, network);
-                                    }
-                                }
-                                if ((response != null) && !(response.getData() instanceof String)) {
-                                    response = getWord(response, network);
-                                }
-                                if (response == null || (!(response.getData() instanceof String) && !response.instanceOf(Primitive.PARAGRAPH))) {
-                                    // Answering must respond.
-                                    if (state == LanguageState.Answering) {
-                                        response = sentence;
-                                    } else {
-                                        continue;
-                                    }
-                                }
-                                log("Response", Level.INFO, response, speaker, conversation);
-                                index++;
-                                if ((sentences.size() == 1) || sentence.instanceOf(Primitive.QUESTION) || (index == sentences.size())) {
-
-                                    if (!response.hasRelationship(Primitive.ASSOCIATED, Primitive.OFFENSIVE)) {
-                                        Vertex meta = null;
-                                        if (this.lastResponseMetaId != null) {
-                                            meta = network.findById(this.lastResponseMetaId);
-                                            this.lastResponseMetaId = null;
-                                        }
-                                        this.bot.mood().evaluateResponse(response, meta);
-                                        this.bot.avatar().evaluateResponse(output, response, meta, variables, network);
-                                        responses.add(response);
-                                    } else {
-                                        response = checkDuplicateOrOffensiveResponse(response, sentence, conversation, input, variables, network, true, false);
-                                        if (!response.hasRelationship(Primitive.ASSOCIATED, Primitive.OFFENSIVE)) {
-                                            Vertex meta = null;
-                                            if (this.lastResponseMetaId != null) {
-                                                meta = network.findById(this.lastResponseMetaId);
-                                                this.lastResponseMetaId = null;
-                                            }
-                                            this.bot.mood().evaluateResponse(response, meta);
-                                            this.bot.avatar().evaluateResponse(output, response, meta, variables, network);
-                                            responses.add(response);
-                                        }
-                                    }
-                                }
-                            }
-                        }
-                        if (responses.isEmpty()) {
-                            if (sense != null) {
-                                sense.notifyExceptionListeners(new BotException("No response"));
-                            }
-                            return;
-                        }
-                        if (inputSense != null) {
-                            // Associate input sense with output.
-                            output.addRelationship(Primitive.SENSE, inputSense);
-                        }
-                        if (speaker != null) {
-                            output.addRelationship(Primitive.TARGET, speaker);
-                        }
-                        Vertex topic = input.mostConscious(Primitive.TOPIC);
-                        if (topic != null) {
-                            output.addRelationship(Primitive.TOPIC, topic);
-                        }
-                        if (input.hasRelationship(Primitive.ASSOCIATED, Primitive.WHISPER)) {
-                            output.addRelationship(Primitive.ASSOCIATED, Primitive.WHISPER);
-                        }
-                        if (!newConversation) {
-                            output.addRelationship(Primitive.QUESTION, input);
-                            input.addRelationship(Primitive.RESPONSE, output);
-                        }
-                        output.addRelationship(Primitive.SPEAKER, self);
-                        //self.addRelationship(Primitive.INPUT, output);
-                        if (responses.get(0).getData() != null) {
-                            output.setName(responses.get(0).getData().toString());
-                        }
-                        if (responses.size() == 1) {
-                            if (this.wasMimic) {
-                                output.addRelationship(Primitive.MIMIC, input);
-                            }
-                            response = responses.get(0);
-                            output.addRelationship(Primitive.INPUT, response);
-                        } else {
-                            Vertex paragraph = network.createInstance(Primitive.PARAGRAPH);
-                            index = 0;
-                            for (Vertex each : responses) {
-                                paragraph.addRelationship(Primitive.SENTENCE, each, index);
-                                index++;
-                            }
-                            output.addRelationship(Primitive.INPUT, paragraph);
-                        }
-                        if (conversation != null) {
-                            Language.addToConversation(output, conversation);
-                        }
-                        this.wasMimic = false;
-                        // Record response time.
-                        output.setCreationDate(new Date());
-                        getBot().memory().save();
-                        // Allow the sense to output the response.
-                        LogUtils.e("[Language]---->output-think",output.printString());
-                        getBot().awareness().output(output);
-                    } catch (RuntimeException exception) {
-                        if (sense != null) {
-                            sense.notifyExceptionListeners(exception);
-                        }
-                        throw exception;
-                    }
-                }
-            } finally {
-                this.recursiveInputDepth = 0;
-                this.recursiveFormulaDepth = 0;
-                this.startTime = 0;
-                this.abort = false;
-            }
-        }
-    }
-
-    /**
-     * Process the input and return the response.
-     */
-    public Vertex input(Vertex input, Vertex sentence, Map<Vertex, Vertex> variables, Network network) {
-        log("REDIRECT", Level.FINE, sentence, this.recursiveInputDepth);
-        if (this.recursiveInputDepth >= MAX_DEPTH) {
-            if (this.recursiveInputDepth == MAX_DEPTH) {
-                this.recursiveInputDepth++;
-                log("Input", Level.WARNING, "Max recursive depth exceeded", this.recursiveInputDepth, sentence);
-            }
-            return null;
-        }
-        this.recursiveInputDepth++;
-        // Check for formula and transpose
-        if (sentence.instanceOf(Primitive.FORMULA)) {
-            Vertex result = evaluateFormula(sentence, variables, network);
-            if (result == null) {
-                log("Template formula cannot be evaluated", Level.FINE, sentence);
-                return null;
-            } else {
-                sentence = getWord(result, network);
-            }
-        }
-        if (sentence.hasRelationship(Primitive.INSTANTIATION, Primitive.SENTENCE) && (sentence.getData() == null)) {
-            sentence = createSentenceText(sentence, network);
-        } else if (!sentence.hasRelationship(Primitive.INSTANTIATION, Primitive.SENTENCE) && (sentence.getData() instanceof String)) {
-            sentence = network.createSentence((String)sentence.getData(), true, false, false);
-        }
-        Vertex conversation = input.getRelationship(Primitive.CONVERSATION);
-        Vertex response = processConversational(input, sentence, conversation, variables, network, LanguageState.Answering);
-        if ((response != null) && response.instanceOf(Primitive.FORMULA)) {
-            log("Response is template formula", Level.FINE, response);
-            SelfCompiler.addGlobalVariables(input, sentence, network, variables);
-            Vertex result = evaluateFormula(response, variables, network);
-            if (result == null) {
-                log("Template formula cannot be evaluated", Level.FINE, response);
-                response = null;
-            } else {
-                response = getWord(result, network);
-            }
-        }
-        this.wasMimic = false;
-        return response;
-    }
-
-    /**
-     * Evaluate the sentence formula/template in the context of the input.
-     */
-    public Vertex evaluateFormula(Vertex formula, Map<Vertex, Vertex> variables, Network network) {
-        return evaluateFormulaTemplate(formula, variables, System.currentTimeMillis(), network);
-    }
-
-    /**
-     * Evaluate the sentence formula/template in the context of the input.
-     */
-    public Vertex evaluateFormulaTemplate(Vertex formula, Map<Vertex, Vertex> variables, long startTime, Network network) {
-        try {
-            //sentence.addRelationship(Primitive.FORMULA, formula);
-            List<Vertex> relationships = formula.orderedRelations(Primitive.WORD);
-            if (relationships == null) {
-                return null;
-            }
-            List<Vertex> words = new ArrayList<Vertex>(relationships.size());
-            boolean caseSensitive = false;
-            long processTime = Math.min(this.maxStateProcess, MAX_PROCCESS_TIME);
-            if (getBot().isDebugFiner()) {
-                processTime = processTime * 10;
-            }
-            for (Vertex word : relationships) {
-                if ((System.currentTimeMillis() - startTime) > processTime) {
-                    throw new SelfExecutionException(formula, "Max formula processing time exceeded");
-                }
-                Vertex result = null;
-                if (word.is(Primitive.WILDCARD)) {
-                    Vertex value = variables.get(word);
-                    if (value == null) {
-                        return null;
-                    }
-                    result = value;
-                } else if (word.instanceOf(Primitive.VARIABLE)) {
-                    Vertex value = variables.get(word);
-                    if (value == null) {
-                        if (word.hasName()) {
-                            value = variables.get(word.getName());
-                        }
-                        if (value == null) {
-                            return null;
-                        }
-                    }
-                    result = value;
-                } else if (word.instanceOf(Primitive.EXPRESSION) || word.instanceOf(Primitive.EQUATION)) {
-                    Vertex quotient = SelfInterpreter.getInterpreter().evaluateExpression(word, variables, network, startTime, processTime, 0);
-                    variables.remove(network.createVertex(Primitive.RETURN));
-                    if (quotient == null) {
-                        return null;
-                    }
-                    while (quotient.instanceOf(Primitive.FORMULA)) {
-                        this.recursiveFormulaDepth++;
-                        if (this.recursiveFormulaDepth > MAX_DEPTH) {
-                            throw new SelfExecutionException(word, "Max recursive template formula execution");
-                        }
-                        quotient = evaluateFormulaTemplate(quotient, variables, startTime, network);
-                        this.recursiveFormulaDepth--;
-                        if (quotient == null) {
-                            return null;
-                        }
-                    }
-                    if (quotient.is(Primitive.NULL)) {
-                        return null;
-                    } else if (quotient.is(Primitive.RETURN)) {
-                        // think: just execute the equation.
-                    } else {
-                        result = quotient;
-                    }
-                    if (result != null && result.hasRelationship(Primitive.TYPE, Primitive.CASESENSITVE)) {
-                        caseSensitive = true;
-                    }
-                } else {
-                    result = word;
-                }
-                if (result != null) {
-                    if (result.instanceOf(Primitive.WORD)) {
-                        words.add(result);
-                    } else if (result.instanceOf(Primitive.SENTENCE) || result.instanceOf(Primitive.FRAGMENT)) {
-                        if (relationships.size() == 1 && (result.instanceOf(Primitive.SENTENCE))) {
-                            return result;
-                        }
-                        Vertex space = null;
-                        Vertex sentenceWithSpaces = result;
-                        // Check if sentence has text or not.
-                        if (result.getData() instanceof String) {
-                            // It is has text, and doesn't contain any spaces, then it must be reparsed with spaces.
-                            if (!result.hasRelationship(Primitive.TYPE, Primitive.SPACE) && !result.hasRelationship(Primitive.WORD, Primitive.SPACE)
-                                    && ((result.getRelationships(Primitive.WORD) == null) || (result.getRelationships(Primitive.WORD).size() > 1))) {
-                                sentenceWithSpaces = network.createSentence((String)result.getData(), true, false, true);
-                            }
-                        } else {
-                            // It is a dynamic sentence, may need to add spaces.
-                            if (!result.hasRelationship(Primitive.TYPE, Primitive.SPACE) && !result.hasRelationship(Primitive.WORD, Primitive.SPACE)) {
-                                space = network.createVertex(Primitive.SPACE);
-                            }
-                        }
-                        List<Vertex> nestedWords = sentenceWithSpaces.orderedRelations(Primitive.WORD);
-                        if (nestedWords != null) {
-                            for (int index = 0; index < nestedWords.size(); index++) {
-                                Vertex nestedWord = nestedWords.get(index);
-                                words.add(nestedWord);
-                                if ((space != null) && (index < (nestedWords.size() - 1))) {
-                                    words.add(space);
-                                }
-                            }
-                        }
-                    } else {
-                        words.add(result);
-                    }
-                }
-            }
-            Vertex sentence = network.createTemporyVertex();
-            sentence.addRelationship(Primitive.INSTANTIATION, Primitive.SENTENCE);
-            if (formula.hasRelationship(Primitive.TYPE, Primitive.SPACE) || formula.hasRelationship(Primitive.WORD, Primitive.SPACE)) {
-                sentence.addRelationship(Primitive.TYPE, Primitive.SPACE);
-            }
-            if (caseSensitive) {
-                sentence.addRelationship(Primitive.TYPE, Primitive.CASESENSITVE);
-            }
-            Vertex previous = network.createVertex(Primitive.NULL);
-            for (int index = 0; index < words.size(); index++) {
-                if ((System.currentTimeMillis() - startTime) > processTime) {
-                    throw new SelfExecutionException(formula, "Max formula processing time exceeded");
-                }
-                Vertex word = words.get(index);
-                if (word.is(Primitive.SPACE)) {
-                    sentence.addRelationship(Primitive.WORD, word, index);
-                    continue;
-                }
-                Vertex next = null;
-                if (words.size() > (index + 1)) {
-                    next = words.get(index + 1);
-                    int nextIndex = index + 2;
-                    while (next.is(Primitive.SPACE) && (nextIndex < words.size())) {
-                        next = words.get(nextIndex);
-                        nextIndex++;
-                    }
-                } else {
-                    next = network.createVertex(Primitive.NULL);
-                }
-                word = getWordFollowing(word, previous, next, network);
-                sentence.addRelationship(Primitive.WORD, word, index);
-                previous = word;
-            }
-            return createSentenceText(sentence, network);
-        } catch (Exception exception) {
-            log(exception);
-            return null;
-        }
-    }
-
-    /**
-     * Determine if the pattern matches the sentence.
-     */
-    public static boolean evaluatePattern(Vertex pattern, Vertex sentence, Primitive variable, Map<Vertex, Vertex> variables, Network network) {
-        List<Vertex> elements = pattern.orderedRelations(Primitive.WORD);
-        List<Vertex> words = sentence.orderedRelations(Primitive.WORD);
-        if (words == null && (sentence.getData() instanceof String) && (!((String)sentence.getData()).isEmpty())) {
-            // Sentence may not have been parsed.
-            sentence = network.createSentence(sentence.getDataValue());
-            words = sentence.orderedRelations(Primitive.WORD);
-        }
-        if (elements == null && (pattern.getData() instanceof String) && (!((String)pattern.getData()).isEmpty()) && (!((String)pattern.getData()).startsWith("Pattern"))) {
-            // Sentence may not have been parsed.
-            sentence = network.createSentence(pattern.getDataValue());
-            elements = sentence.orderedRelations(Primitive.WORD);
-        }
-        if (elements == null || words == null) {
-            return false;
-        }
-        boolean result = evaluatePattern(pattern, sentence, variable, variables, network, elements, words, 0);
-        return result;
-    }
-
-    public static boolean isPunctuation(Vertex word) {
-        if (word.instanceOf(Primitive.PUNCTUATION)) {
-            return true;
-        }
-        if (!(word.getData() instanceof String)) {
-            return false;
-        }
-        if (word.getDataValue().length() != 1) {
-            return false;
-        }
-        char character = word.getDataValue().charAt(0);
-        if (!Character.isLetterOrDigit(character)) {
-            return true;
-        }
-        return false;
-    }
-
-    /**
-     * Determine if the pattern matches the sentence.
-     */
-    public static boolean evaluatePattern(Vertex pattern, Vertex sentence, Primitive variable, Map<Vertex, Vertex> variables, Network network,
-                                          List<Vertex> elements, List<Vertex> words, int wildcardSkip) {
-        boolean wasWildcard = false;
-        int elementIndex = 0;
-        int wildcardSkips = 0;
-        boolean end = false;
-        boolean hadMatchAfterWildcard = false;
-        List<List<Vertex>> star = new ArrayList<List<Vertex>>();
-        List<Vertex> currentStar = null;
-        for (int index = 0; index < words.size(); index++) {
-            if (elementIndex >= elements.size()) {
-                if (!wasWildcard) {
-                    // Ignore trailing punctuation.
-                    while (index < words.size()) {
-                        Vertex word = words.get(index);
-                        if (!isPunctuation(word)) {
-                            if (hadMatchAfterWildcard) {
-                                return evaluatePattern(pattern, sentence, variable, variables, network, elements, words, wildcardSkip + 1);
-                            }
-                            return false;
-                        }
-                        index++;
-                    }
-                    recordStar(star, variable, variables, network);
-                    return true;
-                }
-                end = true;
-            }
-            Vertex element = null;
-            if (!end) {
-                element = elements.get(elementIndex);
-            }
-            Vertex word = words.get(index);
-            boolean required = true;
-            if (element != null) {
-                boolean found = false;
-                if (element == word || element.equals(word)) {
-                    found = true;
-                }
-                if (!found && (element.is(Primitive.WILDCARD) || element.is(Primitive.UNDERSCORE) || element.is(Primitive.HATWILDCARD) || element.is(Primitive.POUNDWILDCARD))) {
-                    wasWildcard = true;
-                    if (currentStar != null) {
-                        star.add(currentStar);
-                    }
-                    currentStar = new ArrayList<Vertex>();
-                    elementIndex++;
-                    // * must match at least one word.
-                    if (element.is(Primitive.WILDCARD) || element.is(Primitive.UNDERSCORE) || elementIndex >= elements.size()) {
-                        currentStar.add(word);
-                        continue;
-                    }
-                    if (elementIndex < elements.size()) {
-                        element = elements.get(elementIndex);
-                    }
-                    while (((elementIndex + 1) < elements.size()) && element.is(Primitive.HATWILDCARD) || element.is(Primitive.POUNDWILDCARD)) {
-                        elementIndex++;
-                        element = elements.get(elementIndex);
-                    }
-                }
-                if (!found) {
-                    if (element.instanceOf(Primitive.ARRAY)) {
-                        required = (element.hasRelationship(Primitive.TYPE, Primitive.REQUIRED));
-                        Collection<Relationship> values = element.getRelationships(Primitive.ELEMENT);
-                        if (values != null) {
-                            for (Relationship value : values) {
-                                if (value.getTarget().getData() instanceof String && word.getData() instanceof String) {
-                                    if (((String)value.getTarget().getData()).equalsIgnoreCase((String)word.getData())) {
-                                        found = true;
-                                    }
-                                } else if (value.getTarget().hasRelationship(Primitive.WORD, word)) {
-                                    found = true;
-                                }
-                                if (found) {
-                                    break;
-                                }
-                            }
-                        }
-                    } else if (element.instanceOf(Primitive.LIST)) {
-                        required = (element.hasRelationship(Primitive.TYPE, Primitive.REQUIRED));
-                        Collection<Relationship> values = element.getRelationships(Primitive.SEQUENCE);
-                        if (values != null) {
-                            for (Relationship value : values) {
-                                if (value.getTarget().getData() instanceof String && word.getData() instanceof String) {
-                                    if (((String)value.getTarget().getData()).equalsIgnoreCase((String)word.getData())) {
-                                        found = true;
-                                    }
-                                } else if (value.getTarget().hasRelationship(Primitive.WORD, word)) {
-                                    found = true;
-                                }
-                                if (found) {
-                                    break;
-                                }
-                            }
-                        }
-                    }
-                }
-                if (!found) {
-                    if (element.instanceOf(Primitive.EXPRESSION) || element.instanceOf(Primitive.EQUATION)) {
-                        element = SelfInterpreter.getInterpreter().evaluateExpression(element, variables, network, System.currentTimeMillis(), MAX_RESPONSE_PROCESS, 0);
-                    }
-                    if (element.instanceOf(Primitive.VARIABLE)
-                            && !(element.is(Primitive.WILDCARD) || element.is(Primitive.UNDERSCORE)
-                            || element.is(Primitive.HATWILDCARD) || element.is(Primitive.POUNDWILDCARD))) {
-                        found = element.matches(word, variables) == Boolean.TRUE;
-                        currentStar = new ArrayList<Vertex>();
-                        currentStar.add(word);
-                        star.add(currentStar);
-                        currentStar = null;
-                        wasWildcard = false;
-                    }
-                }
-                if (!found && (element == word || element.equals(word))) {
-                    found = true;
-                }
-                if (!found && element.getData() instanceof String && word.getData() instanceof String) {
-                    if (((String)element.getData()).equalsIgnoreCase((String)word.getData())) {
-                        found = true;
-                    }
-                } else if (!found) {
-                    // Element is an object, check all words for match.
-                    if (element.hasRelationship(Primitive.WORD, word)) {
-                        found = true;
-                    }
-                }
-                if (found) {
-                    // Must skip matching words to check for other matches if the same word is in the phrase twice.
-                    if (wasWildcard && (wildcardSkips < wildcardSkip)) {
-                        wildcardSkips++;
-                        currentStar.add(word);
-                        continue;
-                    } else {
-                        hadMatchAfterWildcard = hadMatchAfterWildcard || (wasWildcard && elementIndex < elements.size());
-                        elementIndex++;
-                        wasWildcard = false;
-                        if (currentStar != null) {
-                            star.add(currentStar);
-                        }
-                        currentStar = null;
-                        continue;
-                    }
-                }
-            }
-            if ("<".equals(word.getDataValue())) {
-                boolean foundEndTag = false;
-                int tagIndex = index;
-                tagIndex++;
-                // Ignore HTML tags
-                while (tagIndex < words.size()) {
-                    Vertex next = words.get(tagIndex);
-                    if (">".equals(next.getDataValue())) {
-                        foundEndTag = true;
-                        break;
-                    }
-                    tagIndex++;
-                }
-                if (foundEndTag) {
-                    index = tagIndex;
-                    continue;
-                }
-            }
-            if (word.instanceOf(Primitive.PUNCTUATION)) {
-                continue;  // Only ignore real punctuation.
-            }
-            if (wasWildcard) {
-                if (!required) {
-                    elementIndex++;
-                    index--;
-                    continue;
-                }
-                currentStar.add(word);
-                continue;
-            }
-            if (isPunctuation(word)) {
-                continue;
-            }
-            if (!required) {
-                elementIndex++;
-                index--;
-                continue;
-            }
-            if (hadMatchAfterWildcard) {
-                return evaluatePattern(pattern, sentence, variable, variables, network, elements, words, wildcardSkip + 1);
-            }
-            return false;
-        }
-        while (elementIndex < elements.size()) {
-            Vertex element = elements.get(elementIndex);
-            if (element.instanceOf(Primitive.ARRAY) && !element.hasRelationship(Primitive.TYPE, Primitive.REQUIRED)) {
-                elementIndex++;
-            } else if (element.is(Primitive.HATWILDCARD) || element.is(Primitive.POUNDWILDCARD)) {
-                elementIndex++;
-                if (currentStar != null) {
-                    star.add(currentStar);
-                    currentStar = null;
-                } else {
-                    star.add(new ArrayList<Vertex>());
-                }
-            } else {
-                break;
-            }
-        }
-        if (elementIndex >= elements.size()) {
-            if (currentStar != null) {
-                star.add(currentStar);
-            }
-            recordStar(star, variable, variables, network);
-            return true;
-        }
-        if (hadMatchAfterWildcard) {
-            return evaluatePattern(pattern, sentence, variable, variables, network, elements, words, wildcardSkip + 1);
-        }
-        return false;
-    }
-
-    public static void recordStar(List<List<Vertex>> star, Primitive variable, Map<Vertex, Vertex> variables, Network network) {
-        if (star.isEmpty()) {
-            return;
-        } else if (star.size() == 1) {
-            variables.put(network.createVertex(variable), buildStar(star.get(0), variables, network));
-            return;
-        }
-        Vertex starValue = network.createInstance(Primitive.FRAGMENT);
-        int index = 0;
-        for (List<Vertex> words : star) {
-            starValue.addRelationship(Primitive.WORD, buildStar(words, variables, network), index);
-            index++;
-        }
-        variables.put(network.createVertex(variable), starValue);
-    }
-
-    public static Vertex buildStar(List<Vertex> star, Map<Vertex, Vertex> variables, Network network) {
-        if (star.isEmpty()) {
-            return network.createWord("");
-        } else if (star.size() == 1) {
-            return star.get(0);
-        }
-        Vertex starValue = network.createInstance(Primitive.FRAGMENT);
-        int index = 0;
-        for (Vertex word : star) {
-            starValue.addRelationship(Primitive.WORD, word, index);
-            index++;
-        }
-        return starValue;
-    }
-
-    /**
-     * Associate the word to the current context selection.
-     */
-    public Vertex processAssociation(Vertex text, Network network) {
-        Vertex meaning = ((Context)getBot().awareness().getSense(Context.class)).top(network);
-        if (meaning == null) {
-            return null;
-        }
-        text.addRelationship(Primitive.MEANING, meaning);
-        List<Relationship> words = text.orderedRelationships(Primitive.WORD);
-        // Associate as single word or define as compound word.
-        if (words.size() == 1) {
-            Vertex word = words.get(0).getTarget();
-            word.addRelationship(Primitive.MEANING, meaning);
-            meaning.addRelationship(Primitive.WORD, word);
-        } else if (words.size() > 1) {
-            text.addRelationship(Primitive.INSTANTIATION, Primitive.COMPOUND_WORD);
-            text.addRelationship(Primitive.INSTANTIATION, Primitive.WORD);
-            meaning.addRelationship(Primitive.WORD, text);
-            Vertex word = words.get(0).getTarget();
-            word.addRelationship(Primitive.COMPOUND_WORD, text);
-        }
-        Vertex response = meaning.mostConscious(Primitive.WORD);
-        return response;
-    }
-
-    /**
-     * Mark the sentence as a question.
-     */
-    public void checkQuestion(Vertex sentence, Network network) {
-        if (sentence.instanceOf(Primitive.QUESTION)) {
-            log("Sentence is a question", Level.FINE, sentence);
-            return;
-        }
-        Collection<Relationship> words = sentence.getRelationships(Primitive.WORD);
-        if (words != null) {
-            for (Relationship word : words) {
-                Vertex meaning = word.getTarget().mostConscious(Primitive.MEANING);
-                if (meaning != null) {
-                    if (meaning.instanceOf(Primitive.QUESTION)) {
-                        sentence.addRelationship(Primitive.INSTANTIATION, Primitive.QUESTION);
-                        log("Sentence is a question", Level.FINE, sentence, meaning);
-                        break;
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Lookup any urls in the text.
-     */
-    public void processHttp(Vertex sentence, Network network) {
-        Collection<Relationship> words = sentence.getRelationships(Primitive.WORD);
-        if (words != null) {
-            Sense http = getBot().awareness().getSense(Http.class);
-            for (Relationship word : words) {
-                Vertex meaning = word.getTarget().mostConscious(Primitive.MEANING);
-                if (meaning != null) {
-                    if (meaning.instanceOf(Primitive.URL)) {
-                        log("Prcoessing URL", Level.FINE, meaning);
-                        http.input(meaning.getData());
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Process the correction to the last question.
-     */
-    public Vertex processCorrection(Vertex input, Vertex correction, Vertex speaker, Vertex target, Vertex conversation, Network network) {
-        if (!shouldCorrect(input, speaker)) {
-            throw new BotException("You do not have permission to correct");
-        }
-        Vertex originalQuestion = null;
-        Vertex originalQuestionInput = null;
-        if (target != null) {
-            // Get last input said by speaker.
-            originalQuestionInput = getLastInputInConversation(conversation, speaker, 2);
-            if (originalQuestionInput != null) {
-                originalQuestion = originalQuestionInput.mostConscious(Primitive.INPUT);
-            }
-        }
-        if (originalQuestion == null) {
-            log("Correction missing question", Level.FINE, correction);
-            return correction;
-        }
-        // Get last input said by target.
-        Vertex wrongResponseInput = originalQuestionInput.mostConscious(Primitive.RESPONSE);
-        Vertex previousQuestionInput = originalQuestionInput.getRelationship(Primitive.QUESTION);
-        boolean wasCorrect = addCorrection(originalQuestionInput, originalQuestion, wrongResponseInput, correction, previousQuestionInput, network);
-        originalQuestionInput.addRelationship(Primitive.RESPONSE, input);
-        input.addRelationship(Primitive.QUESTION, originalQuestionInput);
-        log("Correction question", Level.FINE, originalQuestion);
-        log("Correction response", Level.FINE, correction);
-        // Check if last response was from understanding and correct state machine.
-        // Do not remove pinned quotients.
-        Vertex quotient = getLastQuotient(network);
-        if (!wasCorrect && (quotient != null) && !quotient.isPinned()) {
-            Vertex state = getLastState(network);
-            log("Correcting quotient", Level.FINE, quotient, state);
-            Relationship relationship = state.getRelationship(Primitive.QUOTIENT, quotient);
-            // Could be a wrong response, or just a wrong response in the context.
-            // First mark wrong in context, then mark wrong in general.
-            if ((relationship == null) || (relationship.getCorrectness() < 0.5)) {
-                originalQuestion.removeRelationship(Primitive.RESPONSE, quotient);
-                network.checkReduction(originalQuestion);
-                originalQuestion.inverseAssociateAll(Primitive.SYNONYM, quotient, Primitive.RESPONSE);
-            } else {
-                relationship.setCorrectness(relationship.getCorrectness() / 2);
-                // Dissociate previous question as meta info.
-                removeSentencePreviousMeta(relationship, previousQuestionInput, network);
-            }
-        }
-        return correction;
-    }
-
-    /**
-     * Process a offensive response.
-     * Remove the sentence.
-     */
-    public void processOffensive(Vertex input, Vertex speaker, Vertex target, Vertex conversation, Network network) {
-        Vertex originalQuestion = null;
-        Vertex originalQuestionInput = null;
-        if (target != null) {
-            // Get last input said by speaker.
-            originalQuestionInput = getLastInputInConversation(conversation, speaker, 2);
-            if (originalQuestionInput != null) {
-                originalQuestion = originalQuestionInput.mostConscious(Primitive.INPUT);
-            }
-        }
-        if (originalQuestion == null) {
-            log("Offensive missing question", Level.FINE);
-            return;
-        }
-        // Get last input said by target.
-        Vertex wrongResponseInput = originalQuestionInput.mostConscious(Primitive.RESPONSE);
-        if (wrongResponseInput == null) {
-            log("Offensive missing response", Level.FINE);
-            return;
-        }
-        Vertex wrongResponse = wrongResponseInput.mostConscious(Primitive.INPUT);
-        if (wrongResponse == null) {
-            log("Offensive missing response input", Level.FINE);
-            return;
-        }
-        if (wrongResponse.hasInverseRelationship(Primitive.ASSOCIATED, Primitive.OFFENSIVE)) {
-            throw new BotException("The response has been marked as not offensive by the bot's admin, so cannot be flagged as offensive.");
-        }
-        log("Offensive response flagged", Bot.WARNING, wrongResponse);
-        // Remove this as a response from all questions.
-        Collection<Relationship> relationships = network.findAllRelationshipsTo(wrongResponse);
-        for (Relationship relationship : relationships) {
-            if (relationship.getType().is(Primitive.RESPONSE)) {
-                relationship.getSource().removeRelationship(relationship.getType(), relationship.getTarget());
-            }
-        }
-        wrongResponseInput.addRelationship(Primitive.ASSOCIATED, Primitive.OFFENSIVE);
-        wrongResponse.addRelationship(Primitive.ASSOCIATED, Primitive.OFFENSIVE);
-        network.checkReduction(wrongResponse);
-        wrongResponse.associateAll(Primitive.SYNONYM, network.createVertex(Primitive.OFFENSIVE), Primitive.ASSOCIATED);
-        // Check if last response was from understanding and correct state machine.
-        // Do not remove pinned quotients.
-        Vertex quotient = getLastQuotient(network);
-        if ((quotient != null) && !quotient.isPinned()) {
-            Vertex state = getLastState(network);
-            log("Correcting quotient", Level.FINE, quotient, state);
-            state.removeRelationship(Primitive.QUOTIENT, quotient);
-        }
-    }
-
-    /**
-     * Process the discussion sentence.
-     * Only response if a question and understood,
-     * or has an exact known response.
-     */
-    public Vertex processDiscussion(Vertex input, Vertex sentence, Vertex conversation, Map<Vertex, Vertex> variables, Network network) {
-        boolean checkUnderstanding = true;
-        Vertex response = null;
-        if (!this.checkExactMatchFirst) {
-            // Try to understand first.
-            response = processUnderstanding(input, sentence, this.discussionMatchPercentage, variables, network);
-            checkUnderstanding = false;
-            if (response != null) {
-                if (sentence.instanceOf(Primitive.QUESTION)) {
-                    log("Discussion sentence understood", Level.FINE, sentence, response);
-                } else {
-                    response = null;
-                    log("Discussion sentence understood, but not a question", Level.FINE, sentence, response);
-                }
-            }
-        }
-        boolean hadResponse = response != null;
-        Relationship relationship = null;
-        if (response == null) {
-            // Check if the sentence has a known response.
-            relationship = bestResponse(this.discussionMatchPercentage, input, sentence, null, null, variables, network);
-            if (relationship != null) {
-                response = relationship.getTarget();
-            }
-            if (response == null && this.checkExactMatchFirst) {
-                // Try to understand first.
-                response = processUnderstanding(input, sentence, this.discussionMatchPercentage, variables, network);
-                checkUnderstanding = false;
-                if (response != null) {
-                    if (sentence.instanceOf(Primitive.QUESTION)) {
-                        log("Discussion sentence understood", Level.FINE, sentence, response);
-                    } else {
-                        response = null;
-                        log("Discussion sentence understood, but not a question", Level.FINE, sentence, response);
-                    }
-                }
-            }
-            hadResponse = response != null;
-            if (response != null) {
-                log("Question known response", Level.FINE, response);
-            } else {
-                Relationship mostConsciousRelationship = sentence.mostConsciousRelationship(Primitive.RESPONSE);
-                hadResponse = mostConsciousRelationship != null;
-                if (mostConsciousRelationship != null) {
-                    log("Question known response was not certain", Level.FINE, mostConsciousRelationship, this.discussionMatchPercentage);
-                    response = null;
-                } else {
-                    log("No known response, checking question patterns", Level.FINE, sentence);
-                    // Try to find a pattern match.
-                    relationship = matchPattern(sentence, null, input, variables, network, this.discussionMatchPercentage);
-                    if (relationship != null) {
-                        response = relationship.getTarget();
-                        log("Question pattern match", Level.FINE, response);
-                    } else {
-                        log("No known response, checking similar questions", Level.FINE, sentence);
-                        // Try to find a good match.
-                        relationship = findResponseMatch(sentence, null, input, variables, network, this.discussionMatchPercentage);
-                        if (relationship != null) {
-                            response = relationship.getTarget();
-                            log("Discussion similar question match", Level.FINE, response);
-                        } else {
-                            // Find the best match for logging.
-                            relationship = findResponseMatch(sentence, null, input, variables, network, 0);
-                            if (relationship != null) {
-                                log("Discussion question match response was not valid", Level.FINE, relationship, this.discussionMatchPercentage);
-                                response = null;
-                            }
-                        }
-                    }
-                }
-            }
-        }
-        if (response == null) {
-            return null;
-        }
-        // Pause to avoid rapid responses, if someone else responds, then don't
-        Vertex lastInput = conversation.lastRelationship(Primitive.INPUT);
-        if (lastInput != null) {
-            Vertex lastSentence = lastInput.mostConscious(Primitive.INPUT);
-            if (lastSentence != sentence) {
-                log("Sentence was already responded to", Level.FINE, sentence, lastSentence);
-                return null;
-            }
-            try {
-                getBot().memory().wait(COVERSATIONAL_RESPONSE_DELAY);
-            } catch (InterruptedException ignore) {}
-            if (getBot().memory().getActiveMemory().size() > 1) {
-                log("New active memory", Level.FINE, getBot().memory().getActiveMemory().size());
-                // Use a new memory to access new input.
-                Network tempMemory = getBot().memory().newMemory();
-                Vertex tempConversation = tempMemory.createVertex(conversation);
-                Vertex tempSentence = tempMemory.createVertex(sentence);
-                lastInput = tempConversation.lastRelationship(Primitive.INPUT);
-                lastSentence = lastInput.mostConscious(Primitive.INPUT);
-                if (lastSentence != tempSentence) {
-                    log("Sentence was already responded to", Level.FINE, sentence, lastSentence);
-                    return null;
-                }
-            }
-        }
-        // Avoid responding the same way twice in a row.
-        if (response != null && conversation != null) {
-            Vertex newResponse = checkDuplicateOrOffensiveResponse(response, sentence, conversation, input, variables, network, !hadResponse, checkUnderstanding);
-            if (response == newResponse && relationship != null && relationship.hasMeta()) {
-                Vertex topic = relationship.getMeta().getRelationship(Primitive.TOPIC);
-                if (topic != null && !topic.instanceOf(Primitive.PATTERN)) {
-                    log("Conversation topic", Level.FINE, topic);
-                    conversation.setRelationship(Primitive.TOPIC, topic);
-                }
-                Vertex think = relationship.getMeta().getRelationship(Primitive.THINK);
-                if (think != null && !think.instanceOf(Primitive.FORMULA)) {
-                    log("Conversation think", Level.FINE, think);
-                    evaluateFormula(think, variables, network);
-                }
-            }
-            response = newResponse;
-        }
-        return response;
-    }
-
-    /**
-     * Check if the response has already been used, and if it has an ONREPEAT response.
-     */
-    public Vertex checkOnRepeat(Vertex response, Vertex conversation, int depth) {
-        if (!response.hasRelationship(Primitive.ONREPEAT) || (depth == 0 && !conversation.hasRelationship(Primitive.SENTENCE, response))) {
-            return null;
-        }
-        if (depth > MAX_DEPTH) {
-            return null;
-        }
-        Collection<Relationship> repeats = response.getRelationships(Primitive.ONREPEAT);
-        // Find unused repeat.
-        for (Relationship repeat : repeats) {
-            if (!conversation.hasRelationship(Primitive.SENTENCE, repeat.getTarget())) {
-                return repeat.getTarget();
-            }
-        }
-        // Find chained repeat.
-        for (Relationship repeat : repeats) {
-            Vertex newResponse = checkOnRepeat(repeat.getTarget(), conversation, depth++);
-            if (newResponse != null) {
-                return newResponse;
-            }
-        }
-        // Find repeat that allows repeats.
-        for (Relationship repeat : repeats) {
-            if (!response.hasRelationship(Primitive.REQUIRE, Primitive.NOREPEAT)) {
-                return repeat.getTarget();
-            }
-        }
-        return null;
-    }
-
-    /**
-     * Check if the previous response was the same and try to find a new one.
-     */
-    public Vertex checkDuplicateOrOffensiveResponse(Vertex response, Vertex sentence, Vertex conversation, Vertex input, Map<Vertex, Vertex> variables, Network network, boolean allowMatch, boolean checkUnderstanding) {
-        Vertex self = network.createVertex(Primitive.SELF);
-        Vertex previousOutput = getLastInputInConversation(conversation, self, 1);
-        Vertex previousResponse = null;
-        if (previousOutput != null) {
-            previousResponse = previousOutput.mostConscious(Primitive.INPUT);
-        }
-        Vertex newResponse = checkOnRepeat(response, conversation, 0);
-        if (newResponse == null) {
-            newResponse = response;
-        }
-        boolean offensive = newResponse.hasRelationship(Primitive.ASSOCIATED, Primitive.OFFENSIVE);
-        boolean repeat = newResponse.hasRelationship(Primitive.REQUIRE, Primitive.NOREPEAT) && conversation.hasRelationship(Primitive.SENTENCE, newResponse);
-        if ((previousResponse == newResponse) || offensive || repeat) {
-            if (offensive) {
-                log("Response was offensive", Level.FINE, response);
-            } else if (repeat) {
-                log("Response was repeat", Level.FINE, response);
-            } else {
-                log("Response was same as previous", Level.FINE, previousResponse);
-            }
-            newResponse = null;
-            if (checkUnderstanding) {
-                // Try to understand first.
-                newResponse = processUnderstanding(input, sentence, this.conversationMatchPercentage, variables, network);
-            }
-            if (newResponse == null) {
-                // Try to find another response.
-                Relationship nextBest = bestResponse(this.conversationMatchPercentage, input, sentence, null, response, variables, network);
-                if (nextBest != null) {
-                    newResponse = nextBest.getTarget();
-                }
-                if ((newResponse == null) && allowMatch) {
-                    // Try to find a good match.
-                    Relationship relationship = matchPattern(sentence, response, input, variables, network, this.conversationMatchPercentage);
-                    if (relationship != null) {
-                        newResponse = relationship.getTarget();
-                    } else {
-                        // Try to find a good match.
-                        relationship = findResponseMatch(sentence, response, input, variables, network, this.conversationMatchPercentage);
-                        if (relationship != null) {
-                            newResponse = relationship.getTarget();
-                        }
-                    }
-                }
-            }
-            if (newResponse == null) {
-                if (offensive) {
-                    log("Response was offensive, no other response available", Level.FINE, response);
-                    return null;
-                }
-                log("Response is duplicate, but no other response available", Level.FINE, previousResponse);
-                // No other response, go with previous one.
-                newResponse = response;
-            } else {
-                if (newResponse.hasRelationship(Primitive.ASSOCIATED, Primitive.OFFENSIVE)) {
-                    log("New response was also offensive", Level.FINE, response);
-                    return null;
-                }
-                Vertex onRepeat = checkOnRepeat(newResponse, conversation, 0);
-                if (onRepeat != null) {
-                    newResponse = onRepeat;
-                }
-                log("Response was duplicate, found another response", Level.FINE, newResponse);
-            }
-        }
-        return newResponse;
-    }
-
-    /**
-     * Return the best response to the question, taking into account the input history.
-     */
-    public Relationship bestResponse(float percentage, Vertex input, Vertex sentence, Vertex question, Vertex previousResponse, Map<Vertex, Vertex> variables, Network network) {
-        return bestResponse(percentage, input, sentence, question, previousResponse, true, true, null, null, null, variables, network);
-    }
-
-    /**
-     * Return the best response to the question, taking into account the input history.
-     */
-    public Relationship bestResponse(float percentage, Vertex input, Vertex sentence, Vertex question, Vertex previousResponse, boolean cascade,
-                                     boolean init, Vertex previousQuestion, Set<String> questionWords, Vertex currentTopic, Map<Vertex, Vertex> variables, Network network) {
-        Collection<Relationship> responses = sentence.getRelationships(Primitive.RESPONSE);
-        Relationship bestResponse = null;
-        if (responses != null) {
-            if (init) {
-                Vertex previousQuestionInput = input.getRelationship(Primitive.QUESTION);
-                if (previousQuestionInput != null) {
-                    previousQuestion = previousQuestionInput.getRelationship(Primitive.INPUT);
-                }
-                Vertex conversation = input.getRelationship(Primitive.CONVERSATION);
-                if (conversation != null) {
-                    currentTopic = conversation.mostConscious(Primitive.TOPIC);
-                }
-                if (question != null) {
-                    questionWords = new HashSet<String>();
-                    Collection<Relationship> relationships = question.getRelationships(Primitive.WORD);
-                    if (relationships != null) {
-                        for (Relationship relationship : relationships) {
-                            questionWords.add(relationship.getTarget().getDataValue().toLowerCase());
-                        }
-                    }
-                }
-            }
-            List<Relationship> best = new ArrayList<Relationship>();
-            List<Relationship> bestWithCondition = new ArrayList<Relationship>();
-            List<Relationship> bestWithTopic = new ArrayList<Relationship>();
-            List<Relationship> bestWithPrevious = new ArrayList<Relationship>();
-            List<Relationship> bestWithTopicPrevious = new ArrayList<Relationship>();
-            for (Relationship response : responses) {
-                if ((response.getCorrectness() >= percentage) && (response.getTarget() != previousResponse)) {
-                    if (response.getTarget().hasRelationship(Primitive.ASSOCIATED, Primitive.OFFENSIVE)) {
-                        continue;
-                    }
-                    Vertex meta = response.getMeta();
-                    if (meta != null) {
-                        if ((previousQuestion == null) && meta.hasRelationship(Primitive.REQUIRE, Primitive.PREVIOUS)) {
-                            continue;
-                        }
-                        Vertex topic = meta.getRelationship(Primitive.TOPIC);
-                        if (!bestWithTopic.isEmpty() && topic == null) {
-                            continue;
-                        }
-                        Collection<Relationship> required = meta.getRelationships(Primitive.REQUIRED);
-                        if ((required != null) && (!required.isEmpty()) && (question != null)) {
-                            // Ensure all required words are in the matched question.
-                            //TODO also check synonyms
-                            boolean found = true;
-                            for (Relationship word : required) {
-                                if (!questionWords.contains(word.getTarget().getDataValue().toLowerCase())) {
-                                    found = false;
-                                    log("Missing required word", Level.FINER, word.getTarget());
-                                    break;
-                                }
-                            }
-                            if (!found) {
-                                continue;
-                            }
-                        } else {
-                            Collection<Relationship> keywords = meta.getRelationships(Primitive.KEYWORD);
-                            if ((keywords != null) && (!keywords.isEmpty()) && (question != null)) {
-                                // Ensure any keywords are in the matched question.
-                                //TODO also check synonyms
-                                boolean found = false;
-                                for (Relationship keyword : keywords) {
-                                    if (questionWords.contains(keyword.getTarget().getDataValue().toLowerCase())) {
-                                        found = true;
-                                        break;
-                                    }
-                                }
-                                if (!found) {
-                                    log("Missing keyword", Level.FINER, keywords);
-                                    continue;
-                                }
-                            }
-                        }
-                        if (topic != null) {
-                            boolean requireTopic = meta.hasRelationship(Primitive.REQUIRE, Primitive.TOPIC);
-                            if (currentTopic == null && requireTopic) {
-                                continue;
-                            }
-                            if (currentTopic != null) {
-                                boolean match = topic == currentTopic;
-                                if (!match && topic.instanceOf(Primitive.PATTERN)) {
-                                    match = evaluatePattern(topic, currentTopic, Primitive.TOPICWILDCARD, new HashMap<Vertex, Vertex>(), network);
-                                }
-                                if (!match && requireTopic) {
-                                    continue;
-                                }
-                                if (match && (bestWithTopic.isEmpty() || (response.getCorrectness() >= bestWithTopic.get(0).getCorrectness()))) {
-                                    if (previousQuestion != null) {
-                                        Vertex label = previousQuestion.getRelationship(Primitive.LABEL);
-                                        if (meta.hasRelationship(Primitive.PREVIOUS, previousQuestion)
-                                                || (label != null && meta.hasRelationship(Primitive.PREVIOUS, label))) {
-                                            if (checkCondition(response, variables, network) != Boolean.FALSE) {
-                                                if (!bestWithTopicPrevious.isEmpty() && (response.getCorrectness() > bestWithTopicPrevious.get(0).getCorrectness())) {
-                                                    bestWithTopicPrevious.clear();
-                                                }
-                                                bestWithTopicPrevious.add(response);
-                                            }
-                                        } else {
-                                            if (meta.hasInverseRelationship(Primitive.PREVIOUS, previousQuestion)
-                                                    || (label != null && meta.hasInverseRelationship(Primitive.PREVIOUS, label))) {
-                                                continue;
-                                            }
-                                            Collection<Relationship> previous = meta.getRelationships(Primitive.PREVIOUS);
-                                            if (previous != null) {
-                                                for (Relationship relationship : previous) {
-                                                    match = evaluatePattern(relationship.getTarget(), previousQuestion, Primitive.THATWILDCARD, new HashMap<Vertex, Vertex>(), network);
-                                                    if (match) {
-                                                        if (checkCondition(response, variables, network) != Boolean.FALSE) {
-                                                            if (!bestWithTopicPrevious.isEmpty() && (response.getCorrectness() > bestWithTopicPrevious.get(0).getCorrectness())) {
-                                                                bestWithTopicPrevious.clear();
-                                                            }
-                                                            bestWithTopicPrevious.add(response);
-                                                        }
-                                                    }
-                                                }
-                                            }
-                                        }
-                                    }
-                                    if (meta.hasRelationship(Primitive.REQUIRE, Primitive.PREVIOUS)) {
-                                        continue;
-                                    }
-                                    if (checkCondition(response, variables, network) != Boolean.FALSE) {
-                                        if (!bestWithTopic.isEmpty() && (response.getCorrectness() > bestWithTopic.get(0).getCorrectness())) {
-                                            bestWithTopic.clear();
-                                        }
-                                        bestWithTopic.add(response);
-                                    }
-                                }
-                            }
-                        }
-                        if ((bestWithTopic.isEmpty()) && (previousQuestion != null) && ((bestWithPrevious.isEmpty()) || (response.getCorrectness() >= bestWithPrevious.get(0).getCorrectness()))) {
-                            boolean match = false;
-                            Vertex label = previousQuestion.getRelationship(Primitive.LABEL);
-                            if (meta.hasRelationship(Primitive.PREVIOUS, previousQuestion)
-                                    || (label != null && meta.hasRelationship(Primitive.PREVIOUS, label))) {
-                                if (checkCondition(response, variables, network) != Boolean.FALSE) {
-                                    if (!bestWithPrevious.isEmpty() && (response.getCorrectness() > bestWithPrevious.get(0).getCorrectness())) {
-                                        bestWithPrevious.clear();
-                                    }
-                                    bestWithPrevious.add(response);
-                                }
-                            } else {
-                                if (meta.hasInverseRelationship(Primitive.PREVIOUS, previousQuestion)
-                                        || (label != null && meta.hasInverseRelationship(Primitive.PREVIOUS, label))) {
-                                    continue;
-                                }
-                                Collection<Relationship> previous = meta.getRelationships(Primitive.PREVIOUS);
-                                if (previous != null) {
-                                    for (Relationship relationship : previous) {
-                                        match = evaluatePattern(relationship.getTarget(), previousQuestion, Primitive.THATWILDCARD, new HashMap<Vertex, Vertex>(), network);
-                                        if (match) {
-                                            if (checkCondition(response, variables, network) != Boolean.FALSE) {
-                                                if (!bestWithPrevious.isEmpty() && (response.getCorrectness() > bestWithPrevious.get(0).getCorrectness())) {
-                                                    bestWithPrevious.clear();
-                                                }
-                                                bestWithPrevious.add(response);
-                                                break;
-                                            }
-                                        }
-                                    }
-                                }
-                            }
-                        }
-                        if (meta.hasRelationship(Primitive.REQUIRE, Primitive.PREVIOUS)) {
-                            continue;
-                        }
-                    }
-                    if ((best.isEmpty()) || (response.getCorrectness() >= best.get(0).getCorrectness())) {
-                        Boolean condition = checkCondition(response, variables, network);
-                        if (condition != Boolean.FALSE) {
-                            if (condition == Boolean.TRUE) {
-                                if (!bestWithCondition.isEmpty() && (response.getCorrectness() > bestWithCondition.get(0).getCorrectness())) {
-                                    bestWithCondition.clear();
-                                }
-                                bestWithCondition.add(response);
-                            }
-                            if (!best.isEmpty() && (response.getCorrectness() > best.get(0).getCorrectness())) {
-                                best.clear();
-                            }
-                            best.add(response);
-                        }
-                    }
-                }
-            }
-            if (!bestWithTopicPrevious.isEmpty()) {
-                bestResponse = Utils.random(bestWithTopicPrevious);
-            } else if (!bestWithTopic.isEmpty()) {
-                bestResponse = Utils.random(bestWithTopic);
-            } else if (!bestWithPrevious.isEmpty()) {
-                bestResponse = Utils.random(bestWithPrevious);
-            } else if (!bestWithCondition.isEmpty()) {
-                bestResponse = Utils.random(bestWithCondition);
-            } else if (!best.isEmpty()) {
-                bestResponse = Utils.random(best);
-            }
-            if (bestResponse != null) {
-                if (bestResponse.hasMeta()) {
-                    this.lastResponseMetaId = bestResponse.getMeta().getId();
-                }
-                return bestResponse;
-            }
-        }
-        if (cascade) {
-            network.checkReduction(sentence);
-            Collection<Relationship> meanings = sentence.getRelationships(Primitive.SYNONYM);
-            if (meanings != null) {
-                for (Relationship meaning : meanings) {
-                    bestResponse = bestResponse(percentage, input, meaning.getTarget(), question, previousResponse, false,
-                            init, previousQuestion, questionWords, currentTopic, variables, network);
-                    if (bestResponse != null) {
-                        return bestResponse;
-                    }
-                }
-            }
-        }
-        return bestResponse;
-    }
-
-    /**
-     * Process the start of a new conversation and output the greeting.
-     */
-    public Vertex processGreeting(Vertex input, Vertex conversation, Network network, LanguageState state, Map<Vertex, Vertex> variables) {
-        Vertex language = network.createVertex(getPrimitive());
-        Collection<Relationship> greetings = language.getRelationships(Primitive.GREETING);
-        if (greetings == null) {
-            log("No greeting", Level.FINE);
-            return null;
-        }
-        Vertex greeting = Utils.random(greetings).getTarget();
-        log("Greeting", Level.FINE, greeting);
-        // Check for formula and transpose
-        if ((greeting != null) && greeting.instanceOf(Primitive.LABEL)) {
-            greeting = greeting.mostConscious(Primitive.RESPONSE);
-        }
-        if ((greeting != null) && greeting.instanceOf(Primitive.FORMULA)) {
-            log("Greeting is template formula", Level.FINE, greeting);
-            Vertex result = evaluateFormula(greeting, variables, network);
-            if (result == null) {
-                log("Template formula cannot be evaluated", Level.FINE, greeting);
-                greeting = null;
-                // Find non formula.
-                for (Relationship relationship : greetings) {
-                    if (!relationship.getTarget().instanceOf(Primitive.FORMULA)) {
-                        greeting = relationship.getTarget();
-                    }
-                }
-            } else {
-                greeting = getWord(result, network);
-            }
-        }
-        return greeting;
-    }
-
-    /**
-     * Process the conversational sentence.
-     * Try to understand, otherwise,
-     * determine the best know response, if there is no known
-     * response, then resort to mimicry.
-     */
-    public Vertex processConversational(Vertex input, Vertex sentence, Vertex conversation, Map<Vertex, Vertex> variables, Network network, LanguageState state) {
-        Vertex response = null;
-        boolean checkUnderstanding = true;
-        if (!this.checkExactMatchFirst) {
-            // Try to understand first.
-            response = processUnderstanding(input, sentence, this.conversationMatchPercentage, variables, network);
-            checkUnderstanding = false;
-        }
-        Relationship relationship = null;
-        if (response == null) {
-            // Check if the sentence has a known response.
-            relationship = bestResponse(0.1f, input, sentence, null, null, variables, network);
-            if (relationship != null) {
-                response = relationship.getTarget();
-            }
-        }
-        if ((response == null) && this.checkExactMatchFirst) {
-            // Try to understand first.
-            response = processUnderstanding(input, sentence, this.conversationMatchPercentage, variables, network);
-            checkUnderstanding = false;
-        }
-        boolean hadResponse = response != null;
-        if (response != null) {
-            log("Question known response", Level.FINE, response);
-        } else {
-            log("No known response, checking question patterns", Level.FINE, sentence);
-            // Try to find a pattern that matches.
-            relationship = matchPattern(sentence, null, input, variables, network, this.conversationMatchPercentage);
-            if (relationship != null) {
-                response = relationship.getTarget();
-                log("Question pattern match", Level.FINE, response);
-            } else {
-                log("No known response, checking similar questions", Level.FINE, sentence);
-                // Try to find a good match.
-                relationship = findResponseMatch(sentence, null, input, variables, network, this.conversationMatchPercentage);
-                if (relationship != null) {
-                    response = relationship.getTarget();
-                    log("Conversation similar question match response", Level.FINE, response);
-                } else  if ((state == LanguageState.Answering) || (state == LanguageState.Discussion)) {
-                    Vertex language = network.createVertex(getPrimitive());
-                    List<Relationship> defaultResponses = language.orderedRelationships(Primitive.RESPONSE);
-                    if (defaultResponses == null) {
-                        if (this.synthesizeResponse) {
-                            response = synthesizeResponse(input, sentence, conversation, false, variables, network);
-                        }
-                        if (response == null) {
-                            this.wasMimic = true;
-                            // Mimic.
-                            log("Conversation mimic", Level.FINE, sentence);
-                            response = sentence;
-                        }
-                    } else {
-                        this.wasMimic = true;
-                        response = getDefaultResponse(defaultResponses, input, sentence, conversation, variables, network);
-                    }
-                }
-            }
-        }
-        // Avoid responding the same way twice in a row.
-        if ((response != null) && (conversation != null)) {
-            Vertex newResponse = checkDuplicateOrOffensiveResponse(response, sentence, conversation, input, variables, network, !hadResponse, checkUnderstanding);
-            if (response == newResponse && relationship != null && relationship.hasMeta()) {
-                Vertex topic = relationship.getMeta().getRelationship(Primitive.TOPIC);
-                if (topic != null && !topic.instanceOf(Primitive.PATTERN)) {
-                    log("Conversation topic", Level.FINE, topic);
-                    conversation.setRelationship(Primitive.TOPIC, topic);
-                }
-                Vertex think = relationship.getMeta().getRelationship(Primitive.THINK);
-                if (think != null && think.instanceOf(Primitive.FORMULA)) {
-                    log("Conversation think", Level.FINE, think);
-                    evaluateFormula(think, variables, network);
-                }
-            }
-            response = newResponse;
-        }
-        return response;
-    }
-
-    /**
-     * Return a synthesized response from linguistic patterns.
-     */
-    public Vertex synthesizeResponse(Vertex input, Vertex sentence, Vertex conversation, boolean random, Map<Vertex, Vertex> variables, Network network) {
-        // Find sentence topic.
-        Vertex topic = null; //conversation.getRelationship(Primitive.TOPIC);
-        if (topic == null && sentence != null) {
-            if (sentence.instanceOf(Primitive.WORD)) {
-                topic = sentence;
-            } else {
-                Collection<Relationship> words = sentence.getRelationships(Primitive.WORD);
-                if (words != null && !words.isEmpty()) {
-                    for (Relationship relationship : words) {
-                        Vertex word = relationship.getTarget();
-                        Vertex meaning = word.mostConscious(Primitive.MEANING);
-                        if (meaning != null && meaning.instanceOf(Primitive.THING)) {
-                            if (topic == null || (meaning.getConsciousnessLevel() > topic.getConsciousnessLevel())) {
-                                topic = word;
-                            }
-                        }
-                    }
-                    if (topic == null) {
-                        for (Relationship relationship : words) {
-                            Vertex word = relationship.getTarget();
-                            Vertex meaning = word.mostConscious(Primitive.MEANING);
-                            if (meaning != null && meaning.instanceOf(Primitive.DESCRIPTION)) {
-                                if (topic == null || (meaning.getConsciousnessLevel() > topic.getConsciousnessLevel())) {
-                                    topic = word;
-                                }
-                            }
-                        }
-                    }
-                    if (topic == null) {
-                        for (Relationship relationship : words) {
-                            Vertex word = relationship.getTarget();
-                            Vertex meaning = word.mostConscious(Primitive.MEANING);
-                            if (meaning != null && meaning.instanceOf(Primitive.ACTION)) {
-                                if (topic == null || (meaning.getConsciousnessLevel() > topic.getConsciousnessLevel())) {
-                                    topic = word;
-                                }
-                            }
-                        }
-                    }
-                    if (topic == null) {
-                        for (Relationship relationship : words) {
-                            Vertex word = relationship.getTarget();
-                            if (topic == null || (word.getConsciousnessLevel() > topic.getConsciousnessLevel())) {
-                                topic = word;
-                            }
-                        }
-                    }
-                }
-            }
-        }
-        List<Vertex> words = new ArrayList<Vertex>();
-        Set<Vertex> usedWords = new HashSet<Vertex>();
-        if (topic != null && !topic.instanceOf(Primitive.WORD)) {
-            topic = topic.mostConscious(Primitive.WORD);
-        }
-        boolean loop = false;
-        if (topic != null) {
-            // Generate sentence start from topic.
-            int count = 0;
-            words.add(topic);
-            usedWords.add(topic);
-            Vertex current = topic;
-            while (count < 5) {
-                Vertex previous = null;
-                if (random) {
-                    Collection<Relationship> relationships = current.getRelationships(Primitive.PREVIOUS);
-                    if (relationships != null) {
-                        previous = Utils.random(relationships).getTarget();
-                        if (loop && usedWords.contains(previous)) {
-                            previous = Utils.random(relationships).getTarget();
-                        }
-                    }
-                } else {
-                    if (loop) {
-                        previous = current.nextMostConscious(Primitive.PREVIOUS, usedWords);
-                    } else {
-                        previous = current.mostConscious(Primitive.PREVIOUS);
-                    }
-                }
-                if (previous == null || previous.is(Primitive.NULL)) {
-                    break;
-                }
-                if (usedWords.contains(previous)) {
-                    loop = true;
-                } else {
-                    usedWords.add(previous);
-                }
-                words.add(0, previous);
-                current = previous;
-                count++;
-            }
-            if (count == 5) {
-                count = 0;
-                while (count < 5) {
-                    if (current.hasRelationship(Primitive.PREVIOUS, Primitive.NULL)) {
-                        break;
-                    }
-                    Vertex previous = null;
-                    if (random) {
-                        Collection<Relationship> relationships = current.getRelationships(Primitive.PREVIOUS);
-                        if (relationships != null) {
-                            previous = Utils.random(relationships).getTarget();
-                            if (loop && usedWords.contains(previous)) {
-                                previous = Utils.random(relationships).getTarget();
-                            }
-                        }
-                    } else {
-                        previous = current.nextMostConscious(Primitive.PREVIOUS, usedWords);
-                    }
-                    if (previous == null || previous.is(Primitive.NULL)) {
-                        break;
-                    }
-                    words.add(0, previous);
-                    usedWords.add(previous);
-                    current = previous;
-                    count++;
-                }
-            }
-
-        }
-        if (topic == null) {
-            topic = network.createVertex(Primitive.NULL);
-        }
-        // Generate sentence end from topic.
-        int count = 0;
-        Vertex current = topic;
-        while (count < 5) {
-            Vertex next = null;
-            if (random) {
-                Collection<Relationship> relationships = current.getRelationships(Primitive.NEXT);
-                if (relationships != null) {
-                    next = Utils.random(relationships).getTarget();
-                    if (loop && usedWords.contains(next)) {
-                        next = Utils.random(relationships).getTarget();
-                    }
-                }
-            } else {
-                if (loop) {
-                    next = current.nextMostConscious(Primitive.NEXT, usedWords);
-                } else {
-                    next = current.mostConscious(Primitive.NEXT);
-                }
-            }
-            if (next == null || next.is(Primitive.NULL)) {
-                break;
-            }
-            if (usedWords.contains(next)) {
-                loop = true;
-            } else {
-                usedWords.add(next);
-            }
-            words.add(next);
-            current = next;
-            count++;
-        }
-        if (count == 5) {
-            count = 0;
-            while (count < 5) {
-                if (current.hasRelationship(Primitive.PREVIOUS, Primitive.NULL)) {
-                    break;
-                }
-                Vertex next = null;
-                if (random) {
-                    Collection<Relationship> relationships = current.getRelationships(Primitive.NEXT);
-                    if (relationships != null) {
-                        next = Utils.random(relationships).getTarget();
-                        if (loop && usedWords.contains(next)) {
-                            next = Utils.random(relationships).getTarget();
-                        }
-                    }
-                } else {
-                    next = current.nextMostConscious(Primitive.NEXT, usedWords);
-                }
-                if (next == null || next.is(Primitive.NULL)) {
-                    break;
-                }
-                words.add(next);
-                usedWords.add(next);
-                current = next;
-                count++;
-            }
-        }
-        if (words.isEmpty()) {
-            return null;
-        }
-        Vertex response = network.createInstance(Primitive.SENTENCE);
-        int index = 0;
-        for (Vertex word: words) {
-            response.addRelationship(Primitive.WORD, word, index);
-            index++;
-        }
-        return response;
-    }
-
-    /**
-     * Check if the response has a condition, and if it evaluates to true.
-     */
-    public Boolean checkCondition(Relationship relationship, Map<Vertex, Vertex> variables, Network network) {
-        if (!relationship.hasMeta()) {
-            return null;
-        }
-        Vertex condition = relationship.getMeta().getRelationship(Primitive.CONDITION);
-        if (condition == null || !condition.instanceOf(Primitive.FORMULA)) {
-            return null;
-        }
-        Vertex result = evaluateFormula(condition, variables, network);
-        if (result != null && result.printString().toLowerCase().equals("true")) {
-            return Boolean.TRUE;
-        }
-        return Boolean.FALSE;
-    }
-
-    /**
-     * Return a random default response for the topic or context.
-     */
-    public Vertex getDefaultResponse(List<Relationship> defaultResponses, Vertex input, Vertex sentence, Vertex conversation, Map<Vertex, Vertex> variables, Network network) {
-        Vertex response = null;
-        Relationship relationship = null;
-        variables.put(network.createVertex(Primitive.WILDCARD), sentence);
-        Vertex previousQuestionInput = input.getRelationship(Primitive.QUESTION);
-        Vertex previousQuestion = null;
-        if (previousQuestionInput != null) {
-            previousQuestion = previousQuestionInput.getRelationship(Primitive.INPUT);
-        }
-        // Check topic
-        if (conversation != null) {
-            Vertex topic = conversation.getRelationship(Primitive.TOPIC);
-            if (topic != null) {
-                Vertex topicMatch = null;
-                Vertex previousMatch = null;
-                Relationship topicMatchRelationship = null;
-                Relationship previousMatchRelationship = null;
-                for (Relationship defaultResponse : defaultResponses) {
-                    if (defaultResponse.hasMeta()) {
-                        Vertex defaultTopic = defaultResponse.getMeta().getRelationship(Primitive.TOPIC);
-                        if (defaultTopic != null) {
-                            boolean match = topic == defaultTopic;
-                            if (!match && defaultTopic.instanceOf(Primitive.PATTERN)) {
-                                match = evaluatePattern(defaultTopic, topic, Primitive.TOPIC, new HashMap<Vertex, Vertex>(), network);
-                            }
-                            if (match) {
-                                if (defaultResponse.getMeta().hasRelationship(Primitive.PREVIOUS)) {
-                                    boolean previousMatches = defaultResponse.getMeta().hasRelationship(Primitive.PREVIOUS, previousQuestion);
-                                    if (!previousMatches) {
-                                        Vertex label = previousQuestion.getRelationship(Primitive.LABEL);
-                                        if (label != null && defaultResponse.getMeta().hasRelationship(Primitive.PREVIOUS, label)) {
-                                            previousMatches = true;
-                                        }
-                                    }
-                                    if (!previousMatches) {
-                                        // Check for patterns.
-                                        Collection<Relationship> previousResponses = defaultResponse.getMeta().getRelationships(Primitive.PREVIOUS);
-                                        if (previousResponses != null) {
-                                            for (Relationship previousResponse : previousResponses) {
-                                                if (!previousResponse.isInverse() && previousResponse.getTarget().instanceOf(Primitive.PATTERN)) {
-                                                    previousMatches = evaluatePattern(previousResponse.getTarget(), previousQuestion, Primitive.PREVIOUS, new HashMap<Vertex, Vertex>(), network);
-                                                    if (previousMatches) {
-                                                        previousMatch = defaultResponse.getTarget();
-                                                        previousMatchRelationship = defaultResponse;
-                                                        log("Conversation topic and previous default response", Level.FINE, defaultTopic, previousMatch);
-                                                        previousMatch = checkDefaultResponseFormula(previousMatch, input, network, variables);
-                                                        if (previousMatch != null) {
-                                                            break;
-                                                        }
-                                                    }
-                                                }
-                                            }
-                                        }
-                                    }
-                                } else if (topicMatch == null) {
-                                    topicMatch = defaultResponse.getTarget();
-                                    topicMatchRelationship = defaultResponse;
-                                    log("Conversation topic default response", Level.FINE, defaultTopic, topicMatch);
-                                    topicMatch = checkDefaultResponseFormula(topicMatch, input, network, variables);
-                                }
-                            }
-                        }
-                    }
-                }
-                if (previousMatch != null) {
-                    response = previousMatch;
-                    relationship = previousMatchRelationship;
-                } else if (topicMatch != null) {
-                    response = topicMatch;
-                    relationship = topicMatchRelationship;
-                }
-            }
-        }
-        if (response == null) {
-            // Check previous.
-            if (previousQuestion != null) {
-                for (Relationship defaultResponse : defaultResponses) {
-                    if (defaultResponse.hasMeta() && defaultResponse.getMeta().hasRelationship(Primitive.PREVIOUS) && !defaultResponse.getMeta().hasRelationship(Primitive.TOPIC)) {
-                        boolean match = defaultResponse.getMeta().hasRelationship(Primitive.PREVIOUS, previousQuestion);
-                        if (!match) {
-                            // Check for patterns.
-                            Collection<Relationship> previousResponses = defaultResponse.getMeta().getRelationships(Primitive.PREVIOUS);
-                            if (previousResponses != null) {
-                                for (Relationship previousResponse : previousResponses) {
-                                    if (!previousResponse.isInverse() && previousResponse.getTarget().instanceOf(Primitive.PATTERN)) {
-                                        match = evaluatePattern(previousResponse.getTarget(), previousQuestion, Primitive.PREVIOUS, new HashMap<Vertex, Vertex>(), network);
-                                        if (match) {
-                                            break;
-                                        }
-                                    }
-                                }
-                            }
-                        }
-                        if (match) {
-                            response = defaultResponse.getTarget();
-                            relationship = defaultResponse;
-                            log("Conversation previous default response", Level.FINE, previousQuestion, response);
-                            response = checkDefaultResponseFormula(response, input, network, variables);
-                            if (response != null) {
-                                break;
-                            }
-                        }
-                    }
-                }
-            }
-        }
-        if (response == null) {
-            // Check conditions.
-            for (Relationship defaultResponse : defaultResponses) {
-                if (checkCondition(defaultResponse, variables, network) == Boolean.TRUE) {
-                    response = defaultResponse.getTarget();
-                    relationship = defaultResponse;
-                    log("Conversation condition default response", Level.FINE, response);
-                    response = checkDefaultResponseFormula(response, input, network, variables);
-                    if (response != null) {
-                        break;
-                    }
-                }
-            }
-        }
-        if (response == null) {
-            List<Relationship> candidates = new ArrayList<Relationship>();
-            for (Relationship defaultResponse : defaultResponses) {
-                if (!defaultResponse.hasMeta() && !conversation.hasRelationship(Primitive.SENTENCE, defaultResponse.getTarget())) {
-                    candidates.add(defaultResponse);
-                }
-            }
-            if (candidates.isEmpty()) {
-                for (Relationship defaultResponse : defaultResponses) {
-                    if (!defaultResponse.hasMeta()
-                            && (!defaultResponse.getTarget().hasRelationship(Primitive.REQUIRE, Primitive.NOREPEAT)
-                            || !conversation.hasRelationship(Primitive.SENTENCE, defaultResponse.getTarget()))) {
-                        candidates.add(defaultResponse);
-                    }
-                }
-            }
-            if (!candidates.isEmpty()) {
-                relationship = Utils.random(candidates);
-                response = relationship.getTarget();
-                log("Conversation default response", Level.FINE, sentence, response);
-                response = checkDefaultResponseFormula(response, input, network, variables);
-            }
-            if (response == null) {
-                // Find non formula.
-                for (Relationship defaultResponse : candidates) {
-                    if (!defaultResponse.getTarget().instanceOf(Primitive.FORMULA)) {
-                        response = defaultResponse.getTarget();
-                        relationship = defaultResponse;
-                    }
-                }
-                if (response == null && !candidates.isEmpty()) {
-                    // Try once more.
-                    relationship = Utils.random(candidates);
-                    response = relationship.getTarget();
-                    response = checkDefaultResponseFormula(response, input, network, variables);
-                }
-                if (response == null) {
-                    // Mimic.
-                    log("Conversation mimic, failed to find default response", Level.FINE, sentence);
-                    response = sentence;
-                    relationship = null;
-                }
-            } else {
-                response = getWord(response, network);
-            }
-        }
-        if (relationship != null && relationship.hasMeta()) {
-            Vertex topic = relationship.getMeta().getRelationship(Primitive.TOPIC);
-            if (topic != null && !topic.instanceOf(Primitive.PATTERN)) {
-                log("Conversation topic", Level.FINE, topic);
-                conversation.setRelationship(Primitive.TOPIC, topic);
-            }
-            Vertex think = relationship.getMeta().getRelationship(Primitive.THINK);
-            if (think != null && !think.instanceOf(Primitive.FORMULA)) {
-                log("Conversation think", Level.FINE, think);
-                evaluateFormula(think, variables, network);
-            }
-        }
-        return response;
-    }
-
-    public Vertex checkDefaultResponseFormula(Vertex response, Vertex input, Network network, Map<Vertex, Vertex> variables) {
-        if ((response != null) && response.instanceOf(Primitive.LABEL)) {
-            response = response.mostConscious(Primitive.RESPONSE);
-        }
-        if ((response != null) && response.instanceOf(Primitive.FORMULA)) {
-            log("Default response is template formula", Level.FINE, response);
-            Vertex result = evaluateFormula(response, variables, network);
-            if (result == null) {
-                log("Template formula cannot be evaluated", Level.FINE, response);
-            }
-            return result;
-        }
-        return response;
-    }
-
-    /**
-     * Return the last thing the speaker said in the conversation.
-     */
-    public Vertex getLastInputInConversation(Vertex conversation, Vertex speaker, int last) {
-        if (conversation == null) {
-            return null;
-        }
-        List<Vertex> allInput = conversation.orderedRelations(Primitive.INPUT);
-        if (allInput != null) {
-            int count = 0;
-            for (int index  = allInput.size() - 1; index >= 0; index--) {
-                Vertex previousInput = allInput.get(index);
-                if (previousInput.mostConscious(Primitive.SPEAKER) == speaker) {
-                    count++;
-                    if (count >= last) {
-                        return previousInput;
-                    }
-                }
-            }
-        }
-        return null;
-    }
-
-    /**
-     * Return if learning should be used for the input.
-     */
-    public boolean shouldLearn(Vertex input, Vertex speaker) {
-        if (this.allowLearning == Boolean.TRUE) {
-            return true;
-        } else if (this.allowLearning == Boolean.FALSE) {
-            return false;
-        }
-        boolean isAdmin = false;
-        boolean isAnonymous = true;
-        if (speaker != null) {
-            isAdmin = speaker.hasRelationship(Primitive.ASSOCIATED, Primitive.ADMINISTRATOR);
-            isAnonymous = speaker.hasRelationship(Primitive.ASSOCIATED, Primitive.ANONYMOUS);
-        }
-        if (this.learningMode == LearningMode.Disabled) {
-            return false;
-        } else if (!isAdmin && (this.learningMode == LearningMode.Administrators)) {
-            if (speaker.is(Primitive.SELF)) {
-                return true;
-            }
-            return false;
-        } else if (isAnonymous && (this.learningMode == LearningMode.Users)) {
-            return false;
-        }
-        return true;
-    }
-
-    /**
-     * Return if learning should be used for the input.
-     */
-    public boolean shouldCorrect(Vertex input, Vertex speaker) {
-        boolean isAdmin = false;
-        boolean isAnonymous = true;
-        if (speaker != null) {
-            isAdmin = speaker.hasRelationship(Primitive.ASSOCIATED, Primitive.ADMINISTRATOR);
-            isAnonymous = speaker.hasRelationship(Primitive.ASSOCIATED, Primitive.ANONYMOUS);
-        }
-        if (this.correctionMode == CorrectionMode.Disabled) {
-            return false;
-        } else if (!isAdmin && (this.correctionMode == CorrectionMode.Administrators)) {
-            return false;
-        } else if (isAnonymous && (this.correctionMode == CorrectionMode.Users)) {
-            return false;
-        }
-        return true;
-    }
-
-    /**
-     * Self API for checking is a user is trusted and should allow correction.
-     */
-    public Vertex allowCorrection(Vertex source, Vertex user) {
-        if (shouldCorrect(null, user)) {
-            return source.getNetwork().createVertex(Primitive.TRUE);
-        }
-        return source.getNetwork().createVertex(Primitive.FALSE);
-    }
-
-    /**
-     * Self API for learning a new response.
-     */
-    public Vertex learn(Vertex source, Vertex question, Vertex response) {
-        log("learn", Level.FINE, question, response);
-        addResponse(question, response, source.getNetwork());
-        return source;
-    }
-
-    /**
-     * Self API for learning a new response.
-     */
-    public Vertex learn(Vertex source, Vertex question, Vertex response, Vertex topic) {
-        log("learn", Level.FINE, question, response);
-        addResponse(question, response, topic.printString(), null, null, source.getNetwork());
-        return source;
-    }
-
-    /**
-     * Self API for synthesizing a new response from a phrase.
-     */
-    public Vertex synthesize(Vertex source, Vertex phrase) {
-        log("synthesize", Level.FINE, phrase);
-        return synthesizeResponse(null, phrase, null, false, null, phrase.getNetwork());
-    }
-
-    /**
-     * Self API for synthesizing a new response.
-     */
-    public Vertex synthesize(Vertex source) {
-        log("synthesize", Level.FINE);
-        return synthesizeResponse(null, null, null, false, null, source.getNetwork());
-    }
-
-    /**
-     * Self API for synthesizing a new response from a phrase.
-     */
-    public Vertex randomSynthesize(Vertex source, Vertex phrase) {
-        log("random synthesize", Level.FINE, phrase);
-        return synthesizeResponse(null, phrase, null, true, null, phrase.getNetwork());
-    }
-
-    /**
-     * Self API for synthesizing a new response.
-     */
-    public Vertex randomSynthesize(Vertex source) {
-        log("random synthesize", Level.FINE);
-        return synthesizeResponse(null, null, null, true, null, source.getNetwork());
-    }
-
-    /**
-     * Self API to print the details of an object.
-     */
-    public Vertex details(Vertex source, Vertex object) {
-        Network network = source.getNetwork();
-        Vertex paragraph = network.createInstance(Primitive.PARAGRAPH);
-        Vertex text = network.createInstance(Primitive.FRAGMENT);
-        Vertex cr = network.createVertex("\n");
-        Vertex bold = network.createVertex("<b>");
-        Vertex boldEnd = network.createVertex("</b>");
-        Vertex ul = network.createVertex("<ul>");
-        Vertex ulEnd = network.createVertex("</ul>");
-        Vertex li = network.createVertex("<li>");
-        Vertex liEnd = network.createVertex("</li>");
-        Vertex dash = network.createVertex("-");
-        int index = 0;
-        int paraIndex = 0;
-        text.addRelationship(Primitive.WORD, bold, index++);
-        text.addRelationship(Primitive.WORD, getWord(object, network), index++);
-        text.addRelationship(Primitive.WORD, boldEnd, index++);
-        text.addRelationship(Primitive.WORD, cr, index++);
-        paragraph.addRelationship(Primitive.SENTENCE, text, paraIndex++);
-        text = network.createInstance(Primitive.FRAGMENT);
-        index = 0;
-        text.addRelationship(Primitive.WORD, ul, index++);
-        text.addRelationship(Primitive.WORD, cr, index++);
-        paragraph.addRelationship(Primitive.SENTENCE, text, paraIndex++);
-        for (Iterator<Relationship> iterator = object.orderedAllRelationships(); iterator.hasNext(); ) {
-            if (paraIndex > 100) {
-                break;
-            }
-            Relationship relationship = iterator.next();
-            if (relationship.isInverse()) {
-                continue;
-            }
-            Vertex type = getWord(relationship.getType(), network);
-            Vertex value = getWord(relationship.getTarget(), network);
-            if (!(value.getData() instanceof String) || ((String)value.getData()).isEmpty()) {
-                //continue;
-            }
-            text = network.createInstance(Primitive.FRAGMENT);
-            index = 0;
-            text.addRelationship(Primitive.WORD, li, index++);
-            text.addRelationship(Primitive.WORD, type, index++);
-            text.addRelationship(Primitive.WORD, dash, index++);
-            text.addRelationship(Primitive.WORD, value, index++);
-            text.addRelationship(Primitive.WORD, liEnd, index++);
-            text.addRelationship(Primitive.WORD, cr, index++);
-            paragraph.addRelationship(Primitive.SENTENCE, text, paraIndex++);
-        }
-        text = network.createInstance(Primitive.FRAGMENT);
-        index = 0;
-        text.addRelationship(Primitive.WORD, ulEnd, index++);
-        paragraph.addRelationship(Primitive.SENTENCE, text, paraIndex++);
-        return paragraph;
-    }
-
-    /**
-     * Self API to create a compound word.
-     * Language.word("very", "nice")
-     * Create a compound word from the arguments.
-     */
-    public Vertex word(Vertex source, Vertex[] arguments) {
-        Network network = source.getNetwork();
-        Vertex nil = network.createVertex(Primitive.NULL);
-        if (arguments.length == 0) {
-            return nil;
-        }
-        StringWriter writer = new StringWriter();
-        List<Vertex> words = new ArrayList<Vertex>();
-        for (Vertex argument : arguments) {
-            if (argument.instanceOf(Primitive.ARRAY)) {
-                List<Vertex> elements = argument.orderedRelations(Primitive.ELEMENT);
-                if (elements != null) {
-                    words.addAll(elements);
-                }
-            } else if (argument.instanceOf(Primitive.LIST)) {
-                List<Vertex> elements = argument.orderedRelations(Primitive.SEQUENCE);
-                if (elements != null) {
-                    words.addAll(elements);
-                }
-            } else {
-                words.add(argument);
-            }
-        }
-        Vertex previousWord = nil;
-        for (int index = 0; index < words.size(); index++) {
-            Vertex word = words.get(index);
-            Vertex nextWord = nil;
-            if (words.size() > (index + 1)) {
-                nextWord = words.get(index + 1);
-            }
-            word = Language.getWordFollowing(word, previousWord, nextWord, network);
-            writer.write(String.valueOf(word.getData()));
-            if ((index + 1) < words.size()) {
-                writer.write(" ");
-            }
-            previousWord = word;
-        }
-        return network.createWord(writer.toString());
-    }
-
-    /**
-     * Self API to define a word.
-     * Language.define("hello", #hello)
-     */
-    public Vertex define(Vertex source, Vertex word, Vertex meaning) {
-        word.addRelationship(Primitive.MEANING, meaning);
-        meaning.addRelationship(Primitive.WORD, word);
-        source.getNetwork().associateCaseInsensitivity((String)word.getData(), meaning);
-        return word;
-    }
-
-    /**
-     * Self API to create a sentence.
-     * Language.sentence("hello", "world")
-     * Create a sentence from the arguments.
-     */
-    public Vertex sentence(Vertex source, Vertex[] arguments) {
-        Network network = source.getNetwork();
-        Vertex result = null;
-        Vertex nil = network.createVertex(Primitive.NULL);
-        if (arguments.length == 0) {
-            result = nil;
-        } else if (arguments.length == 1) {
-            result = arguments[0];
-            if (!(result.getData() instanceof String)) {
-                StringWriter writer = new StringWriter();
-                Vertex text = Language.getWordFollowing(result, nil, nil, network);
-                writer.write(text.getDataValue());
-                result = network.createSentence(writer.toString());
-            } else {
-                result = network.createSentence((String)result.getData());
-            }
-        } else {
-            StringWriter writer = new StringWriter();
-            List<Vertex> words = new ArrayList<Vertex>();
-            for (Vertex argument : arguments) {
-                words.add(argument);
-            }
-            Vertex previousWord = nil;
-            for (int index = 0; index < words.size(); index++) {
-                Vertex word = words.get(index);
-                Vertex nextWord = nil;
-                if (words.size() > (index + 1)) {
-                    nextWord = words.get(index + 1);
-                }
-                word = Language.getWordFollowing(word, previousWord, nextWord, network);
-                writer.write(String.valueOf(word.getData()));
-                if ((index + 1) < words.size()) {
-                    writer.write(" ");
-                }
-                previousWord = word;
-            }
-            result = network.createSentence(writer.toString());
-        }
-        return result;
-    }
-
-    /**
-     * Self API to access last input of a speaker.
-     * Language.getLastInput(speaker)
-     * Get the last input from the conversation for the speaker.
-     */
-    public Vertex getLastInput(Vertex source, Vertex conversation, Vertex speaker) {
-        return getLastInput(source, conversation, speaker, null, null);
-    }
-
-    /**
-     * Self API to access last input of a speaker.
-     * Language.getLastInput(speaker, 1)
-     * Get the last input from the conversation for the speaker.
-     */
-    public Vertex getLastInput(Vertex source, Vertex conversation, Vertex speaker, Vertex index) {
-        return getLastInput(source, conversation, speaker, index, null);
-    }
-
-    /**
-     * Self API to access last input of a speaker.
-     * Language.getLastInput(speaker, 1, 2)
-     * Get the last input from the conversation for the speaker.
-     */
-    public Vertex getLastInput(Vertex source, Vertex conversation, Vertex speaker, Vertex index, Vertex part) {
-        Network network = source.getNetwork();
-        int partValue = 1;
-        if (part != null) {
-            try {
-                partValue = Integer.valueOf(String.valueOf(part.getData()));
-            } catch (Exception exception) {
-                // Ignore, use 1;
-            }
-        }
-        Vertex input = network.createVertex(Primitive.INPUT_VARIABLE);
-        if (conversation == null) {
-            return network.createVertex(Primitive.NULL);
-        }
-        int count = 0;
-        int value = 1;
-        if (index != null) {
-            try {
-                value = Integer.valueOf(String.valueOf(index.getData()));
-            } catch (Exception exception) {
-                // Ignore, use 1;
-            }
-        }
-        List<Vertex> inputs = conversation.orderedRelations(Primitive.INPUT);
-        int element = inputs.size() - 1;
-        while (count < value && element >= 0) {
-            input = inputs.get(element);
-            if (input.hasRelationship(Primitive.SPEAKER, speaker)) {
-                count++;
-                if (count == value) {
-                    Vertex sentence = input.getRelationship(Primitive.INPUT);
-                    if (part == null) {
-                        return sentence;
-                    }
-                    if (!sentence.instanceOf(Primitive.PARAGRAPH)) {
-                        if (partValue == 1) {
-                            return sentence;
-                        }
-                        return network.createVertex(Primitive.NULL);
-                    }
-                    List<Vertex> sentences = sentence.orderedRelations(Primitive.SENTENCE);
-                    if (partValue > sentences.size()) {
-                        return network.createVertex(Primitive.NULL);
-                    }
-                    return sentences.get(partValue - 1);
-                }
-            }
-            element--;
-        }
-        return network.createVertex(Primitive.NULL);
-    }
-
-    /**
-     * Associate the response, attempt to understand.
-     */
-    public Vertex processListening(Vertex input, Vertex sentence, Vertex speaker, Vertex conversation, List<Relationship> targets, Network network, LanguageState state) {
-        if (targets != null) {
-            for (int index = 0; index < targets.size(); index++) {
-                Vertex target = targets.get(index).getTarget();
-                // Get last input said by target.
-                Vertex lastInput = getLastInputInConversation(conversation, target, 1);
-                // Abort if is first question and talking to self.
-                if (input == lastInput) {
-                    return sentence;
-                }
-                if (lastInput == null) {
-                    continue;
-                }
-                Vertex lastSentence = lastInput.mostConscious(Primitive.INPUT);
-                Vertex mimic = lastInput.getRelationship(Primitive.MIMIC);
-                if (mimic != null) {
-                    lastSentence = mimic.mostConscious(Primitive.INPUT);
-                }
-                if (lastSentence == null) {
-                    continue;
-                }
-                float value = 1.0f/(index + (1/this.learningRate));
-                if (!shouldLearn(input, speaker)) {
-                    // Still maintain input state.
-                    lastInput.addWeakRelationship(Primitive.RESPONSE, input, value);
-                    input.addWeakRelationship(Primitive.QUESTION, lastInput, value);
-                } else {
-                    // Associate response.
-                    // Associate previous question as meta info.
-                    Vertex previousQuestionInput = lastInput.getRelationship(Primitive.QUESTION);
-                    sentence.addWeakRelationship(Primitive.QUESTION, lastSentence, value);
-                    lastInput.addWeakRelationship(Primitive.RESPONSE, input, value);
-                    lastSentence.associateAll(Primitive.WORD, lastSentence, Primitive.QUESTION);
-                    input.addWeakRelationship(Primitive.QUESTION, lastInput, value);
-                    Relationship relationship = null;
-                    if (index == 0) {
-                        relationship = getBot().mind().getThought(Comprehension.class).checkTemplate(input, network);
-                        if (relationship == null) {
-                            relationship = lastSentence.addWeakRelationship(Primitive.RESPONSE, sentence, value);
-                            network.checkReduction(lastSentence);
-                            lastSentence.weakAssociateAll(Primitive.SYNONYM, sentence, Primitive.RESPONSE, value);
-                        }
-                    } else {
-                        relationship = lastSentence.addWeakRelationship(Primitive.RESPONSE, sentence, value);
-                    }
-                    addSentencePreviousMeta(relationship, previousQuestionInput, network);
-                }
-                log("Listening sentence", Level.FINE, lastSentence);
-            }
-        }
-        if (speaker != null) {
-            Vertex lastInput = getLastInputInConversation(speaker, conversation, 1);
-            if (lastInput != null) {
-                Vertex lastSentence = lastInput.mostConscious(Primitive.INPUT);
-                if (lastSentence != null) {
-                    lastSentence.addRelationship(Primitive.NEXT, sentence);
-                    sentence.addRelationship(Primitive.PREVIOUS, lastSentence);
-                }
-            }
-        }
-        return sentence;
-    }
-
-    /**
-     * Compute the real value of the sentence.
-     */
-    public int computeMaxSentenceValue(Vertex match, Vertex original, Network network) {
-        Collection<Relationship> words = match.getRelationships(Primitive.WORD);
-        int max = 0;
-        for (Relationship word : words) {
-            boolean found  = false;
-            Vertex lowercase = invertWordCase(word.getTarget(), network);
-            if (original.hasRelationship(Primitive.WORD, word.getTarget())) {
-                found = true;
-            } else {
-                if ((lowercase != null) && (lowercase != word)) {
-                    if (original.hasRelationship(Primitive.WORD, lowercase)) {
-                        found = true;
-                    }
-                }
-                // TODO synonyms, uppercase
-            }
-            if (found) {
-                int value = computeWordValue(word.getTarget());
-                if ((lowercase != null) && (lowercase != word)) {
-                    value = Math.max(value, computeWordValue(lowercase));
-                }
-                max = max + value;
-            }
-        }
-        return max;
-    }
-
-    /**
-     * Return the matching value for the word, some word types are worth more than others.
-     */
-    public int computeWordValue(Vertex word) {
-        int value = 2;
-        int count = 0;
-        if (word.instanceOf(Primitive.NOUN)) {
-            value = value + 12;
-            count++;
-        }
-        if (word.instanceOf(Primitive.ADJECTIVE)) {
-            value = value + 6;
-            count++;
-        }
-        if (word.instanceOf(Primitive.INTERJECTION)) {
-            value = value + 6;
-            count++;
-        }
-        if (word.instanceOf(Primitive.VERB)) {
-            value = value + 4;
-            count++;
-        }
-        if (word.instanceOf(Primitive.QUESTION)) {
-            value = value + 3;
-            count++;
-        }
-        if (word.instanceOf(Primitive.ADVERB)) {
-            value = value + 2;
-            count++;
-        }
-        if (count == 0) {
-            // Check for meaning.
-            Collection<Relationship> meanings = word.getRelationships(Primitive.MEANING);
-            if (meanings != null) {
-                for (Relationship relation : meanings) {
-                    Vertex meaning = relation.getTarget();
-                    // Value nouns and adjective over other words.
-                    if (meaning.instanceOf(Primitive.THING)) {
-                        value = value + 12;
-                    } else if (meaning.instanceOf(Primitive.DESCRIPTION)) {
-                        value = value + 6;
-                    } else if (meaning.instanceOf(Primitive.INTERJECTION)) {
-                        value = value + 6;
-                    } else if (meaning.instanceOf(Primitive.ACTION)) {
-                        value = value + 4;
-                    } else if (meaning.instanceOf(Primitive.QUESTION)) {
-                        value = value + 3;
-                    } else {
-                        value = value + 2;
-                    }
-                    // TODO consider consciousness level, number of relationships
-                }
-                value = value / meanings.size();
-            } else {
-                // Unknown word, may not have discovered it yet, so give it a +4.
-                value = value + 4;
-            }
-        } else {
-            value = value / count;
-        }
-        if (word.instanceOf(Primitive.PUNCTUATION) || (word.instanceOf(Primitive.ARTICLE))) {
-            value = 1;
-        }
-        if (word.instanceOf(Primitive.KEYWORD)) {
-            value = 25;
-        }
-        return value;
-    }
-
-    /**
-     * Add all of the sentences for the word with its value.
-     */
-    public void recordSetenceValues(Vertex word, Vertex originalWord, Collection<Relationship> relationships, int value, Vertex sentence,
-                                    Map<Vertex, Integer> matches, Map<Vertex, Set<Vertex>> processed, Network network, List<Vertex> defer) {
-        if (relationships != null) {
-            if ((defer != null) && relationships.size() > 100) {
-                log("Deferring word", Level.FINER, word, relationships.size());
-                defer.add(word);
-                return;
-            }
-            for (Relationship sentenceRelation : relationships) {
-                Vertex otherSentence = sentenceRelation.getTarget();
-                if (sentence != otherSentence) {
-                    // Only index sentences with responses.
-                    if (otherSentence.hasAnyResponseRelationship()) {
-                        Set<Vertex> processedWords = processed.get(otherSentence);
-                        if (processedWords == null) {
-                            processedWords = new HashSet<Vertex>(4);
-                            processed.put(otherSentence, processedWords);
-                        }
-                        if (processedWords.contains(originalWord)) {
-                            log("Already processed word for sentence", Level.FINEST, word, otherSentence);
-                        } else {
-                            processedWords.add(originalWord);
-                            Integer count = matches.get(otherSentence);
-                            if (count == null) {
-                                count = 0;
-                            }
-                            matches.put(otherSentence, count + value);
-                            log("Increasing question match value", Level.FINER, otherSentence, count + value, value);
-                        }
-                    } else {
-                        log("Sentence has no responses", Level.FINEST, otherSentence);
-                    }
-                }
-            }
-        }
-    }
-
-    /**
-     * Add all of the patterns for the word with its value.
-     */
-    public void recordPatternValues(Vertex word, Vertex sentence, Map<Vertex, Integer> matches, Network network, List<Vertex> defer) {
-        Collection<Relationship> sentenceRelations = word.getRelationships(Primitive.PATTERN);
-        if (sentenceRelations != null) {
-            if ((defer != null) && sentenceRelations.size() > 100) {
-                defer.add(word);
-                return;
-            }
-            int value = computeWordValue(word);
-            for (Relationship sentenceRelation : sentenceRelations) {
-                Vertex otherSentence = sentenceRelation.getTarget();
-                if (sentence != otherSentence) {
-                    // Only index sentences with responses.
-                    if (otherSentence.hasAnyResponseRelationship()) {
-                        Integer count = matches.get(otherSentence);
-                        if (count == null) {
-                            count = 0;
-                        }
-                        matches.put(otherSentence, count + value);
-                    }
-                }
-            }
-            // Record max value.
-            Integer count = matches.get(sentence);
-            if (count == null) {
-                count = 0;
-            }
-            matches.put(sentence, count + value);
-        }
-    }
-
-    public static Vertex invertWordCase(Vertex word, Network network) {
-        if (!(word.getData() instanceof String)) {
-            return null;
-        }
-        String text = (String)word.getData();
-        if (Utils.isCaps(text) || Utils.isCapitalized(text)) {
-            return network.findByData(((String)word.getData()).toLowerCase());
-        } else {
-            return network.findByData(Utils.capitalize((String)word.getData()));
-        }
-    }
-
-    /**
-     * Add all of the questions for all of the words to the matching map.
-     */
-    public void addQuestionMatches(Vertex sentence, Network network, long startTime, long processTime, List<Relationship> wordRelations,
-                                   Map<Vertex, Integer> matches, Map<Vertex, Set<Vertex>> processed, Primitive key, boolean keywords) {
-        List<Vertex> deferred = new ArrayList<Vertex>();
-        for (Relationship wordRelation : wordRelations) {
-            Vertex word = wordRelation.getTarget();
-            Vertex lowercase = invertWordCase(word, network);
-            Vertex uppercase = network.findByData(((String)word.getData()).toUpperCase());
-            if (keywords && (!word.instanceOf(Primitive.KEYWORD)
-                    && (lowercase == null || !lowercase.instanceOf(Primitive.KEYWORD))
-                    && (uppercase == null || !uppercase.instanceOf(Primitive.KEYWORD)))) {
-                continue;
-            }
-            long currentTime = System.currentTimeMillis();
-            if ((currentTime - startTime) > processTime) {
-                log("Search time limit reached (time, matches)", Level.INFO, processTime, matches.size());
-                break;
-            }
-            int value = computeWordValue(word);
-            if ((lowercase != null) && (lowercase != word)) {
-                value = Math.max(value, computeWordValue(lowercase));
-            }
-            if ((uppercase != null) && (uppercase != word)) {
-                value = Math.max(value, computeWordValue(uppercase));
-            }
-            if (key.equals(Primitive.KEYQUESTION)) {
-                value = value + 4; // Weight keyquestion more.
-            }
-            Collection<Relationship> questions = word.getRelationships(key);
-            if (questions != null) {
-                log("Finding similar questions for word (word, value, questions, keyword)", Level.FINER, word.getData(), value, questions.size(), keywords);
-                recordSetenceValues(word, word, questions, value, sentence, matches, processed, network, deferred);
-            }
-            if ((lowercase != null) && (lowercase != word)) {
-                questions = lowercase.getRelationships(key);
-                if (questions != null) {
-                    log("Finding similar questions for word lowercase (word, value, questions, keyword)", Level.FINER, lowercase.getData(), value, questions.size(), keywords);
-                    recordSetenceValues(lowercase, word, questions, value, sentence, matches, processed, network, deferred);
-                }
-            }
-            if ((uppercase != null) && (uppercase != word)) {
-                questions = uppercase.getRelationships(key);
-                if (questions != null) {
-                    log("Finding similar questions for word uppercase (word, value, questions, keyword)", Level.FINER, uppercase.getData(), value, questions.size(), keywords);
-                    recordSetenceValues(uppercase, word, questions, value, sentence, matches, processed, network, deferred);
-                }
-            }
-            // TODO synonyms, plurals, conjegations
-        }
-        // Process keywords with lots of sentences last.
-        for (Vertex word : deferred) {
-            long currentTime = System.currentTimeMillis();
-            if ((currentTime - startTime) > processTime) {
-                log("Search time limit reached (time, matches)", Level.INFO, processTime, matches.size());
-                break;
-            }
-            int value = computeWordValue(word);
-            Vertex lowercase = invertWordCase(word, network);
-            if ((lowercase != null) && (lowercase != word)) {
-                value = Math.max(value, computeWordValue(lowercase));
-            }
-            Vertex uppercase = network.findByData(((String)word.getData()).toUpperCase());
-            if ((uppercase != null) && (uppercase != word)) {
-                value = Math.max(value, computeWordValue(uppercase));
-            }
-            Collection<Relationship> questions = word.getRelationships(key);
-            if (questions != null) {
-                log("Checking deferred word (word, value, questions)", Level.FINER, word.getData(), value, questions.size());
-                recordSetenceValues(word, word, questions, value, sentence, matches, processed, network, null);
-            }
-        }
-    }
-
-    /**
-     * Find the best match for the sentence.
-     * Traverse its words to find other sentences they are used in,
-     * and pick other sentence with the most words in common.
-     */
-    @SuppressWarnings("unchecked")
-    public Relationship findResponseMatch(Vertex sentence, Vertex previousResponse, Vertex input, Map<Vertex, Vertex> variables, Network network, float percentage) {
-        if (!this.enableResponseMatch) {
-            return null;
-        }
-        List<Relationship> wordRelations = sentence.orderedRelationships(Primitive.WORD);
-        if (wordRelations == null) {
-            return null;
-        }
-        long startTime = System.currentTimeMillis();
-        log("Searching for similar questions", Level.FINE);
-        Map<Vertex, Integer> matches = new HashMap<Vertex, Integer>();
-        Map<Vertex, Set<Vertex>> processed = new HashMap<Vertex, Set<Vertex>>();
-        long processTime = Math.min(MAX_PROCCESS_TIME, this.maxResponseMatchProcess);
-        if (getBot().isDebugFine()) {
-            log("Increasing processing time to allow debugging", Level.INFO, getBot().getDebugLevel());
-            processTime = processTime * 20;
-        }
-        // Record all keyword matches.
-        addQuestionMatches(sentence, network, startTime, processTime, wordRelations, matches, processed, Primitive.KEYQUESTION, true);
-        addQuestionMatches(sentence, network, startTime, processTime, wordRelations, matches, processed, Primitive.QUESTION, true);
-        Map<Vertex, Integer> keyWordsMatches = new HashMap<Vertex, Integer>(matches);
-        addQuestionMatches(sentence, network, startTime, processTime, wordRelations, matches, processed, Primitive.QUESTION, false);
-        if (this.learnGrammar) {
-            addQuestionMatches(sentence, network, startTime, processTime, wordRelations, matches, processed, Primitive.SENTENCE, false);
-        }
-
-        // Find the best match.
-        int wordCount = wordRelations.size();
-        double multiplier = (1.0 - percentage) * 15;
-        int tooBig = (int) (wordCount * multiplier) + 2;
-        int tooSmall = 0;
-        Map.Entry<Vertex, Integer> bestMatch = null;
-        int bestAbs = 0;
-        Relationship bestResponse = null;
-        Object[] best = new Object[3];
-        best[0] = bestMatch;
-        best[1] = bestAbs;
-        best[2] = bestResponse;
-        startTime = System.currentTimeMillis();
-        log("Searching for best question match (min words, max words, match size)", Level.FINE, tooSmall, tooBig, matches.size());
-        if (!matches.isEmpty()) {
-            // Pre-compute data
-            Vertex previousQuestionInput = input.getRelationship(Primitive.QUESTION);
-            Vertex previousQuestion = null;
-            if (previousQuestionInput != null) {
-                previousQuestion = previousQuestionInput.getRelationship(Primitive.INPUT);
-            }
-            Vertex conversation = input.getRelationship(Primitive.CONVERSATION);
-            Vertex currentTopic = null;
-            if (conversation != null) {
-                currentTopic = conversation.mostConscious(Primitive.TOPIC);
-            }
-            Set<String> questionWords = new HashSet<String>();
-            Collection<Relationship> wordRelationships = sentence.getRelationships(Primitive.WORD);
-            if (wordRelationships != null) {
-                for (Relationship relationship : wordRelationships) {
-                    questionWords.add(relationship.getTarget().getDataValue().toLowerCase());
-                }
-            }
-            // Search for best response
-            // First check the best value match
-            int bestValue = 0;
-            Map.Entry<Vertex, Integer> bestEntry = null;
-            Map.Entry<Vertex, Integer> secondBestEntry = null;
-            for (Map.Entry<Vertex, Integer> entry : matches.entrySet()) {
-                if (entry.getValue() > bestValue && (sentence != entry.getKey())) {
-                    bestValue = entry.getValue();
-                    bestEntry = entry;
-                    secondBestEntry = bestEntry;
-                }
-            }
-            if (bestEntry != null) {
-                checkBetterMatch(bestEntry, keyWordsMatches, best, tooBig, tooSmall, wordCount,
-                        percentage, input, bestEntry.getKey(), sentence, previousResponse, true, false, previousQuestion, questionWords, currentTopic, variables, network);
-            }
-            if (best[0] == null && secondBestEntry != null) {
-                checkBetterMatch(secondBestEntry, keyWordsMatches, best, tooBig, tooSmall, wordCount,
-                        percentage, input, secondBestEntry.getKey(), sentence, previousResponse, true, false, previousQuestion, questionWords, currentTopic, variables, network);
-            }
-            int count = 0;
-            for (Map.Entry<Vertex, Integer> entry : matches.entrySet()) {
-                long currentTime = System.currentTimeMillis();
-                if ((currentTime - startTime) > processTime) {
-                    log("Process time limit reached (time, matches, processed)", Level.INFO, processTime, matches.size(), count);
-                    break;
-                }
-                count++;
-                checkBetterMatch(entry, keyWordsMatches, best, tooBig, tooSmall, wordCount,
-                        percentage, input, entry.getKey(), sentence, previousResponse, true, false, previousQuestion, questionWords, currentTopic, variables, network);
-            }
-        }
-        bestMatch = (Map.Entry<Vertex, Integer>) best[0];
-        bestAbs = (Integer) best[1];
-        bestResponse= (Relationship) best[2];
-        if (bestResponse == null) {
-            log("No valid question match", Level.FINE);
-            return null;
-        }
-        if (keyWordsMatches.containsKey(bestMatch.getKey())) {
-            log("Question keyword match", Level.FINE);
-        } else {
-            int max = computeMaxSentenceValue(bestMatch.getKey(), bestMatch.getKey(), network);
-            // If % then ok.
-            double required = max * percentage * 0.8;
-            // Recompute value using all words, as some words may not store relation to sentence.
-            int matchValue = computeMaxSentenceValue(bestMatch.getKey(), sentence, network);
-            log("Question best match (score, max score, required score, question)", Level.FINE, matchValue, max, required, bestMatch.getKey());
-            if (matchValue < required) {
-                log("Question bad match, insufficient score (score, required score, question)", Level.FINE, matchValue, required, bestMatch.getKey());
-                this.lastResponseMetaId = null;
-                return null;
-            }
-            int matchMax = computeMaxSentenceValue(bestMatch.getKey(), bestMatch.getKey(), network);
-            if (matchValue * multiplier < matchMax) {
-                log("Question bad match, too generic (score, multiplier, value, match max, question)", Level.FINE, matchValue, multiplier, matchValue * multiplier, matchMax, bestMatch.getKey());
-                this.lastResponseMetaId = null;
-                return null;
-            }
-        }
-        log("Question match response", Level.FINE, bestResponse);
-        return bestResponse;
-    }
-
-    @SuppressWarnings("unchecked")
-    public void checkBetterMatch(Map.Entry<Vertex, Integer> entry, Map<Vertex, Integer> keyWordsMatches, Object[] best, int tooBig, int tooSmall, int wordCount,
-                                 float percentage, Vertex input, Vertex sentence, Vertex question, Vertex previousResponse, boolean cascade,
-                                 boolean init, Vertex previousQuestion, Set<String> questionWords, Vertex currentTopic, Map<Vertex, Vertex> variables, Network network) {
-        Map.Entry<Vertex, Integer> bestMatch = (Map.Entry<Vertex, Integer>) best[0];
-        int bestAbs = (Integer) best[1];
-        if (bestMatch != null && (entry.getValue() < bestMatch.getValue())) {
-            return;
-        }
-        if (question == entry.getKey() || entry.getKey().instanceOf(Primitive.PATTERN)) {
-            return;
-        }
-        log("Processing (value, question)", Level.FINER, entry.getValue(), entry.getKey());
-        Collection<Relationship> relationships = entry.getKey().getRelationships(Primitive.WORD);
-        if (relationships == null) {
-            return;
-        }
-        int entryWordCount = relationships.size();
-        boolean hasKeyword = keyWordsMatches.containsKey(entry.getKey());
-        // Ignore if too big or too small.
-        if (hasKeyword || (entryWordCount <= tooBig) && (entryWordCount >= tooSmall)) {
-            int entryAbs = Math.abs(wordCount - entryWordCount);
-            if (bestMatch == null || (entry.getValue() > bestMatch.getValue()) || (entryAbs < bestAbs)) {
-                Relationship response = null;
-                response = bestResponse(percentage, input, entry.getKey(), sentence, previousResponse,
-                        false, false, previousQuestion, questionWords, currentTopic, variables, network);
-                if (response != null) {
-                    log("Better question match (value, question)", Level.FINE, entry.getValue(), entry.getKey());
-                    best[0] = entry;
-                    best[1] = entryAbs;
-                    best[2] = response;
-                }
-            }
-        }
-    }
-
-    /**
-     * Find the best pattern that matches the sentence.
-     */
-    public Relationship matchPattern(Vertex sentence, Vertex previousResponse, Vertex input, Map<Vertex, Vertex> variables, Network network, float percentage) {
-        List<Relationship> wordRelations = sentence.orderedRelationships(Primitive.WORD);
-        if (wordRelations == null) {
-            return null;
-        }
-        long startTime = System.currentTimeMillis();
-        Map<Vertex, Integer> matches = new HashMap<Vertex, Integer>();
-        long processTime = Math.min(MAX_PROCCESS_TIME, this.maxResponseMatchProcess);
-        // Record all of the matches.
-        List<Vertex> deferred = new ArrayList<Vertex>();
-        for (Relationship wordRelation : wordRelations) {
-            long currentTime = System.currentTimeMillis();
-            if ((currentTime - startTime) > processTime) {
-                log("Pattern search time limit reached", Level.INFO, processTime, matches.size());
-                break;
-            }
-            Vertex word = wordRelation.getTarget();
-            recordPatternValues(word, sentence, matches, network, deferred);
-            Vertex lowercase = null;
-            if (!(word.getData() instanceof String)) {
-                return null;
-            }
-            String text = (String)word.getData();
-            if (Utils.isCaps(text) || Utils.isCapitalized(text)) {
-                lowercase = network.findByData(((String)word.getData()).toLowerCase());
-            } else {
-                lowercase = network.findByData(Utils.capitalize((String)word.getData()));
-            }
-            if ((lowercase != null) && (lowercase != word)) {
-                recordPatternValues(lowercase, sentence, matches, network, deferred);
-            }
-        }
-        // Process words with lots of sentences last.
-        for (Vertex word : deferred) {
-            long currentTime = System.currentTimeMillis();
-            if ((currentTime - startTime) > processTime) {
-                log("Pattern search time limit reached", Level.INFO, processTime, matches.size());
-                break;
-            }
-            recordPatternValues(word, sentence, matches, network, null);
-        }
-        // Find the best match.
-        Map.Entry<Vertex, Integer> bestMatch = null;
-        Relationship bestResponse = null;
-        boolean bestHasUnderscore = false;
-        startTime = System.currentTimeMillis();
-        log("Found possible patterns", Level.FINE, matches.size());
-        if (!matches.isEmpty()) {
-            // Pre-compute data
-            Vertex previousQuestionInput = input.getRelationship(Primitive.QUESTION);
-            Vertex previousQuestion = null;
-            if (previousQuestionInput != null) {
-                previousQuestion = previousQuestionInput.getRelationship(Primitive.INPUT);
-            }
-            Vertex conversation = input.getRelationship(Primitive.CONVERSATION);
-            Vertex currentTopic = null;
-            if (conversation != null) {
-                currentTopic = conversation.mostConscious(Primitive.TOPIC);
-            }
-            Set<String> questionWords = new HashSet<String>();
-            Collection<Relationship> wordRelationships = sentence.getRelationships(Primitive.WORD);
-            if (wordRelationships != null) {
-                for (Relationship relationship : wordRelationships) {
-                    questionWords.add(relationship.getTarget().getDataValue().toLowerCase());
-                }
-            }
-            for (Map.Entry<Vertex, Integer> entry : matches.entrySet()) {
-                long currentTime = System.currentTimeMillis();
-                if ((currentTime - startTime) > processTime) {
-                    log("Pattern process time limit reached", Level.INFO, processTime, matches.size());
-                    break;
-                }
-                if (sentence == entry.getKey()) {
-                    continue;
-                }
-                if (bestMatch == null) {
-                    if (!evaluatePattern(entry.getKey(), sentence, Primitive.WILDCARD, variables, network)) {
-                        continue;
-                    }
-                    bestResponse = bestResponse(percentage, input, entry.getKey(), sentence, previousResponse,
-                            false, false, previousQuestion, questionWords, currentTopic, variables, network);
-                    if (bestResponse != null) {
-                        bestMatch = entry;
-                        bestHasUnderscore = entry.getKey().hasRelationship(Primitive.WORD, Primitive.UNDERSCORE)
-                                || entry.getKey().hasRelationship(Primitive.WORD, Primitive.POUNDWILDCARD)
-                                || entry.getKey().hasRelationship(Primitive.TYPE, Primitive.PRECEDENCE);
-                    }
-                } else {
-                    boolean hasUnderscore = entry.getKey().hasRelationship(Primitive.WORD, Primitive.UNDERSCORE)
-                            || entry.getKey().hasRelationship(Primitive.WORD, Primitive.POUNDWILDCARD)
-                            || entry.getKey().hasRelationship(Primitive.TYPE, Primitive.PRECEDENCE);
-                    if (entry.getValue() > bestMatch.getValue() || (hasUnderscore && ! bestHasUnderscore)) {
-                        if (!evaluatePattern(entry.getKey(), sentence, Primitive.WILDCARD, variables, network)) {
-                            continue;
-                        }
-                        Relationship response = bestResponse(percentage, input, entry.getKey(), sentence, previousResponse,
-                                false, false, previousQuestion, questionWords, currentTopic, variables, network);
-                        if (response != null) {
-                            bestResponse = response;
-                            if (bestResponse != null) {
-                                bestMatch = entry;
-                                bestHasUnderscore = hasUnderscore;
-                            }
-                        }
-                    }
-                }
-            }
-        }
-        if (bestResponse == null) {
-            log("No valid pattern", Level.FINE);
-            return null;
-        }
-        log("Pattern match", Level.FINE, bestMatch.getKey(), bestResponse);
-        return bestResponse;
-    }
-
-    /**
-     * Attempt to understand the sentence using state machines.
-     */
-    public Vertex processUnderstanding(Vertex input, Vertex sentence, float correctnessRequired, Map<Vertex, Vertex> variables, Network network) {
-        if (!sentence.hasRelationship(Primitive.WORD)) {
-            return null;
-        }
-        // Lookup and apply language rules.
-        // Use read-only states to improve performance, as they will not be modified.
-        Network readOnlyMemory = getBot().memory().getLongTermMemory();
-        Vertex language = readOnlyMemory.createVertex(getPrimitive());
-        List<Vertex> states = language.orderedRelations(Primitive.STATE);
-        if (states == null || states.isEmpty()) {
-            return null;
-        }
-        List<Vertex> compoundWords = processCompoundWords(sentence.orderedRelationships(Primitive.WORD));
-        Vertex compoundSentence = sentence;
-        // Check if the input has compound words.
-        if (compoundWords != null) {
-            if (compoundWords != null) {
-                // Sentence had compound words, so need to create new sentence and switch input.
-                compoundSentence = network.createInstance(Primitive.SENTENCE);
-                for (int index = 0; index < compoundWords.size(); index++) {
-                    Vertex word = compoundWords.get(index);
-                    compoundSentence.addRelationship(Primitive.WORD, word, index);
-                }
-            }
-        }
-        List<Vertex> inputs = new ArrayList<Vertex>(1);
-        inputs.add(input);
-        Vertex response = checkState(null, input, compoundSentence, states, 0, 0, inputs, variables, new ArrayList<Vertex>(), correctnessRequired, network);
-        if ((response == null) && (compoundWords != null)) {
-            // If had compound words, also check without them.
-            variables = new HashMap<Vertex, Vertex>();
-            SelfCompiler.addGlobalVariables(input, sentence, network, variables);
-            response = checkState(null, input, sentence, states, 0, 0, inputs, variables, new ArrayList<Vertex>(), correctnessRequired, network);
-        }
-        if (response != null) {
-            response = getWord(response, network);
-            if (response != null) {
-                log("Sentence understood", Level.FINE, sentence, response);
-            } else {
-                log("Sentence understood but no words", Level.FINE, sentence);
-                response = null;
-            }
-        } else {
-            log("Sentence not understood", Level.FINE, sentence);
-        }
-        return response;
-    }
-
-    /**
-     * Transform the list of words, into a list of compound words.
-     */
-    public List<Vertex> processCompoundWords(List<Relationship> words) {
-        List<Vertex> compoundedWords = new ArrayList<Vertex>(words.size());
-        for (int index = 0; index < words.size(); index++) {
-            Vertex word = words.get(index).getTarget();
-            // Get the compound words for each word.
-            Collection<Relationship> compoundWords = word.getRelationships(Primitive.COMPOUND_WORD);
-            if (compoundWords == null) {
-                // No compound words, so just add the single word.
-                compoundedWords.add(word);
-            } else {
-                boolean found = false;
-                // Check each compound word, to see if it follows the word.
-                for (Relationship compundWord : compoundWords) {
-                    int compoundIndex = 1;
-                    List<Relationship> wordParts = compundWord.getTarget().orderedRelationships(Primitive.WORD);
-                    if ((wordParts == null) || (wordParts.size() <= 1)) {
-                        // Avoid corrupt data (from forgetfullness).
-                        break;
-                    }
-                    // Check that all the compound words are contained.
-                    while (((index + compoundIndex) < words.size()) && (compoundIndex < wordParts.size())) {
-                        Vertex wordPart = wordParts.get(compoundIndex).getTarget();
-                        Vertex nextWord = words.get(index + compoundIndex).getTarget();
-                        // If the words don't match, then stop checking and check the next compound word.
-                        if (!wordPart.equals(nextWord)) {
-                            break;
-                        }
-                        compoundIndex++;
-                    }
-                    // If the compound word is a match, the add it.
-                    // TODO: What if multiple compound words match?  Take longest, or most conscious?
-                    if (compoundIndex == wordParts.size()) {
-                        found = true;
-                        log("Compound word found", Level.FINE, compundWord.getTarget());
-                        compoundedWords.add(compundWord.getTarget());
-                        index = index + compoundIndex - 1;
-                        break;
-                    }
-                }
-                if (!found) {
-                    for (Relationship compundWord : compoundWords) {
-                        int compoundIndex = 1;
-                        List<Relationship> wordParts = compundWord.getTarget().orderedRelationships(Primitive.WORD);
-                        if ((wordParts == null) || (wordParts.size() <= 1)) {
-                            // Avoid corrupt data (from forgetfullness).
-                            break;
-                        }
-                        // Check that all the compound words are contained.
-                        while (((index + compoundIndex) < words.size()) && (compoundIndex < wordParts.size())) {
-                            Vertex wordPart = wordParts.get(compoundIndex).getTarget();
-                            Vertex nextWord = words.get(index + compoundIndex).getTarget();
-                            // If the words don't match, then stop checking and check the next compound word.
-                            if (!wordPart.equalsIgnoreCase(nextWord)) {
-                                break;
-                            }
-                            compoundIndex++;
-                        }
-                        // If the compound word is a match, the add it.
-                        // TODO: What if multiple compound words match?  Take longest, or most conscious?
-                        if (compoundIndex == wordParts.size()) {
-                            found = true;
-                            log("Compound word found", Level.FINE, compundWord.getTarget());
-                            compoundedWords.add(compundWord.getTarget());
-                            index = index + compoundIndex - 1;
-                            break;
-                        }
-                    }
-                }
-                if (!found) {
-                    compoundedWords.add(word);
-                }
-            }
-        }
-        if (words.size() == compoundedWords.size()) {
-            return null;
-        }
-        return compoundedWords;
-    }
-
-    /**
-     * Apply each state machine vertex to the sentence of words.
-     * If the state machine finds a match, it will record the real vertices mapped to the state machine variables.
-     */
-    public Vertex checkState(Vertex root, Vertex input, Vertex sentence, List<Vertex> states, int index, int recurse, List<Vertex> inputs, Map<Vertex, Vertex> variables, List<Vertex> stateStack, float correctnessRequired, Network network) {
-        if (states == null || this.abort) {
-            return null;
-        }
-        if (this.startTime == 0) {
-            this.startTime = System.currentTimeMillis();
-        }
-        long processTime = Math.min(this.maxStateProcess, MAX_PROCCESS_TIME);
-        if (getBot().isDebugFiner()) {
-            processTime = processTime * 10;
-        }
-        Vertex state = null;
-        try {
-            while (index <= inputs.size()) {
-                Vertex currentInput = null;
-                if (index < inputs.size()) {
-                    currentInput = inputs.get(index);
-                }
-                // Check each state machine for a match.
-                for (ListIterator<Vertex> iterator = states.listIterator(); iterator.hasNext(); ) {
-                    if (this.abort) {
-                        return null;
-                    }
-                    if ((System.currentTimeMillis() - this.startTime) > processTime) {
-                        log("State processing time limit reached", Level.WARNING, processTime, root, state);
-                        this.abort = true;
-                        return null;
-                    }
-                    if (stateStack.size() > MAX_STACK) {
-                        log("State stack overflow", Level.WARNING, MAX_STACK, root, state);
-                        this.abort = true;
-                        return null;
-                    }
-                    // Record local variables so they can be discarded if there is no match.
-                    Map<Vertex, Vertex> localVariables = new HashMap<Vertex, Vertex>(variables);
-                    state = iterator.next();
-                    Vertex lastState = null;
-                    if (!stateStack.isEmpty()) {
-                        lastState = stateStack.get(stateStack.size() - 1);
-                    }
-                    stateStack.add(state);
-                    Vertex newRoot = root;
-                    Vertex decompiled = SelfDecompiler.getDecompiler().decompileState(state, state.getNetwork());
-                    if (root == null) {
-                        newRoot = state;
-                        log("STATE MACHINE", Level.FINE, state, currentInput);
-                        if (!this.loadedStates.contains(state.getId()) && (stateStack.size() == 1) && this.loadedStates.size() < 20) {
-                            this.loadedStates.add(state.getId());
-                            SelfCompiler.getCompiler().fastLoadChildren(state);
-                        }
-                        // Record root state variable.
-                        localVariables.put(network.createVertex(Primitive.STATE), decompiled);
-                    } else {
-                        log("STATE", Level.FINER, state, currentInput);
-                    }
-                    Collection<Relationship> equations = decompiled.orderedRelationships(Primitive.DO);
-                    Vertex response = null;
-                    if (equations != null) {
-                        for (Relationship equationRelationship : equations) {
-                            if (this.abort) {
-                                return null;
-                            }
-                            if ((System.currentTimeMillis() - this.startTime) > processTime) {
-                                log("State processing time limit reached", Level.WARNING, processTime, root, state);
-                                this.abort = true;
-                                return null;
-                            }
-                            Vertex equation = equationRelationship.getTarget();
-                            if (equation.instanceOf(Primitive.CASE) || equation.hasRelationship(Primitive.PATTERN)) {
-
-                                List<Relationship> fors = equation.orderedRelationships(Primitive.FOR);
-                                if (fors != null) {
-                                    fors = null;
-                                }
-                                Vertex pattern = equation.getRelationship(Primitive.PATTERN);
-                                Vertex caseVariable = null;
-                                Boolean match = false;
-                                boolean anyOrNone = false;
-                                boolean emptyMatch = false;
-                                if (pattern != null) {
-                                    log("PATTERN", Level.FINER, pattern, currentInput);
-                                    caseVariable = pattern;
-                                    // Avoid checking pattern again if in recursive state.
-                                    if (lastState != state) {
-                                        match = evaluatePattern(pattern, sentence, Primitive.WILDCARD, localVariables, network);
-                                    }
-                                } else {
-                                    caseVariable = equation.getRelationship(Primitive.CASE);
-                                    if (caseVariable != null && (!caseVariable.isVariable())) {
-                                        if ((caseVariable.instanceOf(Primitive.EXPRESSION) || caseVariable.instanceOf(Primitive.EQUATION))) {
-                                            caseVariable = SelfInterpreter.getInterpreter().evaluateExpression(caseVariable, localVariables, network, this.startTime, processTime, 0);
-                                        } else if (caseVariable.instanceOf(Primitive.FUNCTION)) {
-                                            caseVariable = SelfInterpreter.getInterpreter().evaluateFunction(caseVariable, localVariables, network, this.startTime, processTime, 0);
-                                        }
-                                    }
-                                    if (caseVariable != null) {
-                                        anyOrNone = (caseVariable.getName() != null && (caseVariable.getName().equals("poundstar") || caseVariable.getName().equals("hatstar")))
-                                                || ((caseVariable.instanceOf(Primitive.ARRAY) || caseVariable.instanceOf(Primitive.LIST))
-                                                && !caseVariable.hasRelationship(Primitive.TYPE, Primitive.REQUIRED));
-                                    }
-                                    if (index >= inputs.size()) {
-                                        if (anyOrNone) {
-                                            emptyMatch = true;
-                                            match = Boolean.TRUE;
-                                            log("CASE", Level.FINER, caseVariable, currentInput);
-                                        } else {
-                                            continue;
-                                        }
-                                    } else {
-                                        currentInput = inputs.get(index);
-                                        log("CASE", Level.FINER, caseVariable, currentInput);
-                                        if (caseVariable != null) {
-                                            match = caseVariable.matches(currentInput, localVariables);
-                                            if (match != Boolean.TRUE && caseVariable.isPrimitive() && currentInput != null && currentInput.instanceOf(Primitive.WORD)) {
-                                                // Also allow primitive to match words meaning.
-                                                if (currentInput.hasRelationship(Primitive.MEANING, caseVariable)) {
-                                                    match = true;
-                                                }
-                                            }
-                                            if (currentInput == input) {
-                                                Vertex sentenceVariable = caseVariable.getRelationship(Primitive.INPUT);
-                                                if (sentenceVariable != null) {
-                                                    localVariables.put(sentenceVariable, sentence);
-                                                }
-                                            }
-                                        }
-                                        if (match != Boolean.TRUE && anyOrNone) {
-                                            emptyMatch = true;
-                                            match = Boolean.TRUE;
-                                        }
-                                    }
-                                }
-                                if (match == Boolean.TRUE) {
-                                    Vertex topic = equation.getRelationship(Primitive.TOPIC);
-                                    if (topic != null) {
-                                        match = false;
-                                        Vertex conversation = input.getRelationship(Primitive.CONVERSATION);
-                                        Vertex currentTopic = null;
-                                        if (conversation != null) {
-                                            currentTopic = conversation.getRelationship(Primitive.TOPIC);
-                                        }
-                                        log("Checking topic", Level.FINER, topic, currentTopic);
-                                        if (currentTopic != null) {
-                                            match = evaluatePattern(topic, currentTopic, Primitive.TOPICWILDCARD, localVariables, network);
-                                        }
-                                    }
-                                    Vertex that = equation.getRelationship(Primitive.THAT);
-                                    if (match && (that != null)) {
-                                        match = false;
-                                        Vertex questionInput = input.getRelationship(Primitive.QUESTION);
-                                        log("Checking that", Level.FINER, that, questionInput);
-                                        if (questionInput != null) {
-                                            Vertex question = questionInput.getRelationship(Primitive.INPUT);
-                                            if (question != null) {
-                                                match = evaluatePattern(that, question, Primitive.THATWILDCARD, localVariables, network);
-                                                if (!match) {
-                                                    // Check if the question was a paragraph, then need to check eat part.
-                                                    network.createParagraph(question);
-                                                    if (question.instanceOf(Primitive.PARAGRAPH)) {
-                                                        Collection<Relationship> relationships = question.getRelationships(Primitive.SENTENCE);
-                                                        if (relationships != null) {
-                                                            for (Relationship relationship : relationships) {
-                                                                match = evaluatePattern(that, relationship.getTarget(), Primitive.THATWILDCARD, localVariables, network);
-                                                                if (match) {
-                                                                    break;
-                                                                }
-                                                            }
-                                                        }
-                                                    }
-                                                }
-                                            }
-                                        }
-                                    }
-                                }
-                                // Check if the word matches the state machine variable.
-                                if (match == Boolean.TRUE) {
-                                    if (pattern != null) {
-                                        log("PATTERN MATCH", Level.FINE, pattern, currentInput);
-                                    } else {
-                                        log("CASE MATCH", Level.FINER, caseVariable, currentInput);
-                                    }
-                                    // Check next state/word recursively.
-                                    Vertex template = equation.getRelationship(Primitive.TEMPLATE);
-                                    if (template != null) {
-                                        if (template.instanceOf(Primitive.EQUATION) || template.instanceOf(Primitive.EXPRESSION)
-                                                || template.instanceOf(Primitive.FUNCTION)) {
-                                            response = evaluateAnswerResponse(template, state, localVariables, network);
-                                            if (response != null) {
-                                                return response;
-                                            }
-                                        } else {
-                                            if (template.getNetwork() != network) {
-                                                template = network.createVertex(template);
-                                            }
-                                            if ((template != null) && template.instanceOf(Primitive.LABEL)) {
-                                                template = template.mostConscious(Primitive.RESPONSE);
-                                            }
-                                            if (template.instanceOf(Primitive.FORMULA)) {
-                                                log("Template is template formula", Level.FINE, template);
-                                                response = evaluateFormula(template, localVariables, network);
-                                                if (response == null) {
-                                                    log("Template formula cannot be evaluated", Level.FINE, template);
-                                                } else {
-                                                    return response;
-                                                }
-                                            } else if (template.instanceOf(Primitive.EQUATION) || template.instanceOf(Primitive.EXPRESSION)
-                                                    || template.instanceOf(Primitive.FUNCTION)) {
-                                                response = evaluateAnswerResponse(template, state, localVariables, network);
-                                                if (response != null) {
-                                                    return response;
-                                                }
-                                            } else {
-                                                return template;
-                                            }
-                                        }
-                                    }
-                                    // Check for AS, maps case variable into target variable.
-                                    Vertex as = equation.getRelationship(Primitive.AS);
-                                    if (as != null) {
-                                        localVariables.put(as, localVariables.get(caseVariable));
-                                    }
-                                    List<Vertex> gotoStates = equation.orderedRelations(Primitive.GOTO);
-                                    if (gotoStates != null) {
-                                        if ((gotoStates.size() == 1) && gotoStates.get(0).is(Primitive.RETURN)) {
-                                            log("CASE RETURN", Level.FINER);
-                                            return null;
-                                        }
-                                        List<Relationship> arguments = equation.orderedRelationships(Primitive.FOR);
-                                        List<Vertex> newInputs = inputs;
-                                        int newIndex = index + 1;
-                                        if (arguments != null) {
-                                            Vertex variable = arguments.get(1).getTarget();
-                                            Vertex value = arguments.get(0).getTarget();
-                                            newInputs = new ArrayList<Vertex>();
-                                            Vertex variableValue = SelfInterpreter.getInterpreter().evaluateExpression(variable, localVariables, network, this.startTime, processTime, 0);
-                                            List<Relationship> relationships = variableValue.orderedRelationships(value);
-                                            if (relationships != null) {
-                                                for (Relationship result : relationships) {
-                                                    newInputs.add(result.getTarget());
-                                                }
-                                            }
-                                            newIndex = 0;
-                                        }
-                                        log("CASE GOTO STATE", Level.FINER, gotoStates);
-                                        if (!emptyMatch) {
-                                            response = checkState(newRoot, input, sentence, gotoStates, newIndex, recurse, newInputs, localVariables, stateStack, correctnessRequired, network);
-                                        }
-                                        if (response != null) {
-                                            return response;
-                                        }
-                                        if (anyOrNone && (newIndex == index + 1) &&  !gotoStates.contains(state)) {
-                                            // Also check matching nothing.
-                                            response = checkState(newRoot, input, sentence, gotoStates, index, recurse, newInputs, localVariables, stateStack, correctnessRequired, network);
-                                        }
-                                        if (response != null) {
-                                            return response;
-                                        }
-                                    }
-                                } else {
-                                    log("Case not matched", Level.FINER, caseVariable, currentInput);
-                                }
-                            } else if (equation.instanceOf(Primitive.DO)) {
-                                log("DO", Level.FINER, state, currentInput);
-                                SelfInterpreter.getInterpreter().evaluateExpression(equation.getRelationship(Primitive.DO), localVariables, network, this.startTime, processTime, 0);
-                                localVariables.remove(network.createVertex(Primitive.RETURN));
-                            } else if (equation.instanceOf(Primitive.GOTO)) {
-                                // May require terminal state.
-                                if (!equation.hasRelationship(Primitive.FINALLY) || (index >= inputs.size())) {
-                                    List<Vertex> gotoStates = equation.orderedRelations(Primitive.GOTO);
-                                    log("GOTO", Level.FINER, state, gotoStates);
-                                    List<Vertex> arguments = equation.orderedRelations(Primitive.ARGUMENT);
-                                    if (arguments == null || arguments.isEmpty()) {
-                                        response = checkState(newRoot, input, sentence, gotoStates, index, recurse, inputs, localVariables, stateStack, correctnessRequired, network);
-                                    } else {
-                                        List<Vertex> newInputs = new ArrayList<Vertex>();
-                                        for (Vertex argument : arguments) {
-                                            newInputs.add(SelfInterpreter.getInterpreter().evaluateExpression(argument, localVariables, network, this.startTime, processTime, 0));
-                                        }
-                                        response = checkState(newRoot, input, sentence, gotoStates, 0, recurse, newInputs, localVariables, stateStack, correctnessRequired, network);
-                                    }
-                                    if (response != null) {
-                                        return response;
-                                    }
-                                }
-                            } else if (equation.instanceOf(Primitive.PUSH)) {
-                                Vertex argument = equation.getRelationship(Primitive.ARGUMENT);
-                                argument = SelfInterpreter.getInterpreter().evaluateExpression(argument, localVariables, network, this.startTime, processTime, 0);
-                                log("PUSH", Level.FINER, state, argument);
-                                inputs.add(index, argument);
-                            } else if (equation.instanceOf(Primitive.RETURN)) {
-                                log("RETURN", Level.FINER, state, currentInput);
-                                List<Vertex> lastStates = new ArrayList<Vertex>(1);
-                                Vertex current = stateStack.remove(stateStack.size() - 1);
-                                Vertex last = stateStack.remove(stateStack.size() - 1);
-                                lastStates.add(last);
-                                Map<Vertex, Vertex> newVariables = localVariables;
-                                // Allow the return to clear the variable stack, or keep specific variables.
-                                Collection<Relationship> arguments = equation.getRelationships(Primitive.ARGUMENT);
-                                if (arguments != null) {
-                                    newVariables = new HashMap<Vertex, Vertex>(variables);
-                                    for (Relationship variable : arguments) {
-                                        newVariables.put(variable.getTarget(), localVariables.get(variable.getTarget()));
-                                    }
-                                }
-                                // A return value is used as the next state value, (reruns the previous state with the new value).
-                                Vertex value = equation.getRelationship(Primitive.RETURN);
-                                if (value != null && value.isVariable()) {
-                                    value = localVariables.get(value);
-                                    if (value == null) {
-                                        value = network.createVertex(Primitive.NULL);
-                                    }
-                                }
-                                if (value != null) {
-                                    List<Vertex> newInputs = new ArrayList<Vertex>(inputs);
-                                    if (currentInput == null) {
-                                        newInputs.add(value);
-                                    } else {
-                                        index++;
-                                        newInputs.add(index, value);
-                                    }
-                                    recurse++;
-                                    if (recurse > MAX_DEPTH) {
-                                        stateStack.add(last);
-                                        stateStack.add(current);
-                                        throw new SelfExecutionException(current, "Max recursive state execution");
-                                    }
-                                    response = checkState(newRoot, input, sentence, lastStates, index++, recurse, newInputs, newVariables, stateStack, correctnessRequired, network);
-                                } else {
-                                    response = checkState(newRoot, input, sentence, lastStates, index++, recurse, inputs, newVariables, stateStack, correctnessRequired, network);
-                                }
-                                if (response != null) {
-                                    return response;
-                                }
-                                stateStack.add(last);
-                                stateStack.add(current);
-                            }
-                        }
-                    }
-                    // Ignore punctuation.
-                    if (currentInput != null && currentInput.instanceOf(Primitive.PUNCTUATION)) {
-                        response = checkState(newRoot, input, sentence, states, index+1, recurse, inputs, localVariables, stateStack, correctnessRequired, network);
-                        if (response != null) {
-                            return response;
-                        }
-                    }
-
-                    // Check if the entire sentence was matched.
-                    if ((index >= inputs.size())) {
-                        Vertex[] pair = bestAnswer(correctnessRequired, decompiled, localVariables, input, sentence, network);
-                        if (pair != null) {
-                            response = pair[1];
-                            log("ANSWER", Level.FINER, state, response);
-                            Vertex quotient = pair[0];
-                            setLastStateMachine(root);
-                            setLastState(state);
-                            setLastQuotient(quotient);
-                            return response;
-                        }
-                    }
-                    stateStack.remove(stateStack.size() - 1);
-                    log("STATE DONE", Level.FINER, state, currentInput);
-                }
-                index++;
-                return null;
-            }
-        } catch (Exception failure) {
-            log("Error occured in processing state", Level.WARNING, root, state);
-            log(failure);
-            return null;
-        } finally {
-            if (root == null) {
-                log("State processing time", Level.FINE, System.currentTimeMillis() - startTime);
-            }
-        }
-        return null;
-    }
-
-    /**
-     * Return the best response to the question, taking into account the input history.
-     */
-    public Vertex[] bestAnswer(float percentage, Vertex state, Map<Vertex, Vertex> localVariables, Vertex input, Vertex sentence, Network network) {
-        // Check if any response has the same previous question.
-        Vertex previousQuestionInput = input.getRelationship(Primitive.QUESTION);
-        Vertex previousQuestion = null;
-        if (previousQuestionInput != null) {
-            previousQuestion = previousQuestionInput.getRelationship(Primitive.INPUT);
-            if (previousQuestion != null) {
-                Collection<Relationship> quotients = state.getRelationships(Primitive.QUOTIENT);
-                if (quotients != null) {
-                    Vertex bestResponse = null;
-                    Relationship best = null;
-                    Relationship bestWithPrevious = null;
-                    for (Relationship quotient : quotients) {
-                        if (quotient.getCorrectness() >= percentage) {
-                            Vertex meta = quotient.getMeta();
-                            if (meta != null) {
-                                if (hasPrevious(meta, previousQuestion, state, localVariables, network)) {
-                                    if ((bestWithPrevious == null) || (quotient.getCorrectness() > bestWithPrevious.getCorrectness())) {
-                                        Vertex response = evaluateAnswerResponse(quotient.getTarget(), state, localVariables, network);
-                                        if ((response == null) || sentence.hasInverseRelationship(Primitive.RESPONSE, response)
-                                                || sentence.hasAnyAssociatedInverseRelationship(Primitive.SYNONYM, response, Primitive.RESPONSE)) {
-                                            continue;
-                                        } else {
-                                            bestWithPrevious = quotient;
-                                            bestResponse = response;
-                                        }
-                                    }
-                                }
-                                Vertex label = previousQuestion.getRelationship(Primitive.LABEL);
-                                if (meta.hasInverseRelationship(Primitive.PREVIOUS, previousQuestion)
-                                        || (label != null && meta.hasInverseRelationship(Primitive.PREVIOUS, label))
-                                        || meta.hasRelationship(Primitive.REQUIRE, Primitive.PREVIOUS)) {
-                                    continue;
-                                }
-                            }
-                            if ((bestWithPrevious == null) && ((best == null) || (quotient.getCorrectness() > best.getCorrectness()))) {
-                                Vertex response = evaluateAnswerResponse(quotient.getTarget(), state, localVariables, network);
-                                if ((response == null) || sentence.hasInverseRelationship(Primitive.RESPONSE, response)
-                                        || sentence.hasAnyAssociatedInverseRelationship(Primitive.SYNONYM, response, Primitive.RESPONSE)) {
-                                    continue;
-                                } else {
-                                    best = quotient;
-                                    bestResponse = response;
-                                }
-                            }
-                        }
-                    }
-                    if (bestWithPrevious != null) {
-                        Vertex[] pair = new Vertex[2];
-                        pair[0] = bestWithPrevious.getTarget();
-                        pair[1] = bestResponse;
-                        return pair;
-                    }
-                    if (bestResponse == null) {
-                        return null;
-                    }
-                    Vertex[] pair = new Vertex[2];
-                    pair[0] = best.getTarget();
-                    pair[1] = bestResponse;
-                    return pair;
-                }
-            }
-        }
-        Vertex quotient = state.mostConscious(Primitive.QUOTIENT, percentage);
-        if (quotient == null) {
-            return null;
-        }
-        Vertex response = evaluateAnswerResponse(quotient, state, localVariables, network);
-        if ((response == null) || sentence.hasInverseRelationship(Primitive.RESPONSE, response)
-                || sentence.hasAnyAssociatedInverseRelationship(Primitive.SYNONYM, response, Primitive.RESPONSE)) {
-            quotient = state.nextMostConscious(Primitive.QUOTIENT, quotient, percentage);
-            response = evaluateAnswerResponse(quotient, state, localVariables, network);
-            if ((response == null) || sentence.hasInverseRelationship(Primitive.RESPONSE, response)
-                    || sentence.hasAnyAssociatedInverseRelationship(Primitive.SYNONYM, response, Primitive.RESPONSE)) {
-                return null;
-            }
-        }
-        Vertex[] pair = new Vertex[2];
-        pair[0] = quotient;
-        pair[1] = response;
-        return pair;
-    }
-
-    /**
-     * Return the best response to the question, taking into account the input history.
-     */
-    public boolean hasPrevious(Vertex meta, Vertex sentence, Vertex state, Map<Vertex, Vertex> localVariables, Network network) {
-        Collection<Relationship> relationship = meta.getRelationships(Primitive.PREVIOUS);
-        if (relationship == null) {
-            return false;
-        }
-        if (meta.hasRelationship(Primitive.PREVIOUS, sentence)) {
-            return true;
-        }
-        Vertex label = sentence.getRelationship(Primitive.LABEL);
-        if (label != null && meta.hasRelationship(Primitive.PREVIOUS, label)) {
-            return true;
-        }
-        for (Relationship previous : relationship) {
-            if (previous.getTarget().instanceOf(Primitive.FORMULA)) {
-                log("Previous is template formula", Level.FINE, previous.getTarget());
-                Vertex result = evaluateFormula(previous.getTarget(), localVariables, network);
-                if (result == null) {
-                    log("Template formula cannot be evaluated", Level.FINE, previous.getTarget());
-                } else if (result.equals(sentence)) {
-                    return true;
-                }
-            }
-        }
-        return false;
-    }
-
-    /**
-     * Evaluate the quotient and possible formula response.
-     */
-    public Vertex evaluateAnswerResponse(Vertex answer, Vertex state, Map<Vertex, Vertex> localVariables, Network network) {
-        Vertex response = null;
-        if (answer != null) {
-            long processTime = Math.min(this.maxStateProcess, MAX_PROCCESS_TIME);
-            if (getBot().isDebugFiner()) {
-                processTime = processTime * 10;
-            }
-            log("Evaluating answer", Level.FINE, answer, state);
-            response = SelfInterpreter.getInterpreter().evaluateExpression(answer, localVariables, network, this.startTime, processTime, 0);
-            localVariables.remove(network.createVertex(Primitive.RETURN));
-            log("Answer result", Level.FINE, response);
-            // Check for formula and transpose
-            if ((response != null) && response.instanceOf(Primitive.LABEL)) {
-                response = response.mostConscious(Primitive.RESPONSE);
-            }
-            if ((response != null) && response.instanceOf(Primitive.FORMULA)) {
-                log("Answer is template formula", Level.FINE, response);
-                response = evaluateFormula(response, localVariables, network);
-                if (response == null) {
-                    log("Template formula cannot be evaluated", Level.FINE, response);
-                }
-            } else if ((response != null) && !response.hasData() && (response.instanceOf(Primitive.SENTENCE) || response.instanceOf(Primitive.FRAGMENT))
-                    && !response.instanceOf(Primitive.PARAGRAPH)) {
-                response = createSentenceText(response, network);
-            }
-            if ((response != null) && response.is(Primitive.NULL)) {
-                response = null;
-            }
-        }
-        return response;
-    }
-
-    /**
-     * Create the text for the sentence.
-     */
-    public Vertex createSentenceText(Vertex vertex, Network network) {
-        StringWriter writer = new StringWriter();
-        List<Relationship> relationships = vertex.orderedRelationships(Primitive.WORD);
-        Vertex previous = network.createVertex(Primitive.NULL);
-        boolean inferWhitespace = !vertex.hasRelationship(Primitive.TYPE, Primitive.SPACE) && !vertex.hasRelationship(Primitive.WORD, Primitive.SPACE);
-        boolean caseSensitive = !this.fixFormulaCase || vertex.hasRelationship(Primitive.TYPE, Primitive.CASESENSITVE);
-        if (relationships != null) {
-            boolean first = true;
-            String last = null;
-            for (int index = 0; index < relationships.size(); index++) {
-                Relationship relationship = relationships.get(index);
-                Vertex next = network.createVertex(Primitive.NULL);
-                if (relationships.size() > (index + 1)) {
-                    next = relationships.get(index + 1).getTarget();
-                }
-                Vertex word = relationship.getTarget();
-                if (word.is(Primitive.SPACE)) {
-                    writer.write(" ");
-                    continue;
-                }
-                if (!(word.getData() instanceof String)) {
-                    word = getWordFollowing(word, relationship, previous, next, network);
-                }
-                String text = word.printString();
-                if (!caseSensitive) {
-                    if (first) {
-                        text = Utils.capitalize(text);
-                    } else if (text.equals("i") || text.equals("I")) {
-                        text = text.toUpperCase();
-                    } else {
-                        boolean isName = word.instanceOf(Primitive.NAME);
-                        boolean isNoun = word.instanceOf(Primitive.NOUN);
-                        boolean isVerb = word.instanceOf(Primitive.VERB) || word.instanceOf(Primitive.ARTICLE)
-                                || word.instanceOf(Primitive.PRONOUN) || word.instanceOf(Primitive.QUESTION);
-                        if (isName && !isVerb) {
-                            text = Utils.capitalize(text);
-                        } else if (isVerb && !isName && !isNoun) {
-                            text = text.toLowerCase();
-                        }
-                    }
-                }
-                if (inferWhitespace) {
-                    if (!first && !text.equals("'") && !text.equals(")") && !"(".equals(last) && !"'".equals(last) && !text.equals("^") && !"^".equals(last) && (!(word.instanceOf(Primitive.PUNCTUATION)))) {
-                        writer.write(" ");
-                    }
-                }
-                writer.write(text);
-                first = text.equals(".");
-                previous = word;
-                last = text;
-            }
-        }
-        String text = writer.toString();
-        Vertex sentence = network.createSentence(text.trim(), true);
-        if (vertex.hasRelationship(Primitive.TYPE, Primitive.CASESENSITVE)) {
-            sentence.addRelationship(Primitive.TYPE, Primitive.CASESENSITVE);
-        }
-        return sentence;
-    }
-
-    /**
-     * Return the sentence or word for the vertex.
-     */
-    public Vertex getWord(Vertex vertex, Network network) {
-        if (vertex.instanceOf(Primitive.SENTENCE) || vertex.instanceOf(Primitive.WORD)) {
-            if (!vertex.hasData()) {
-                // If it was a self created sentence it may not have text.
-                vertex = createSentenceText(vertex, network);
-            }
-            if (!vertex.instanceOf(Primitive.SENTENCE)) {
-                vertex.addRelationship(Primitive.INSTANTIATION, Primitive.SENTENCE);
-            }
-            return vertex;
-        }
-        // May be a string that needs to be converted to a sentence.
-        if (vertex.hasData() && (vertex.getData() instanceof String)) {
-            return network.createSentence((String)vertex.getData());
-        }
-        if (vertex.instanceOf(Primitive.PARAGRAPH)) {
-            return vertex;
-        }
-        Vertex previous = network.createVertex(Primitive.NULL);
-        return getWordFollowing(vertex, previous, previous, network);
-    }
-
-    /**
-     * Return the sentence or word for the vertex.
-     */
-    public static Vertex getWordFollowing(Vertex vertex, Vertex previousWord, Vertex nextWord, Network network) {
-        return getWordFollowing(vertex, null, previousWord, nextWord, network);
-    }
-
-    /**
-     * Return the sentence or word for the vertex.
-     */
-    public static Vertex getWordFollowing(Vertex vertex, Relationship relationship, Vertex previousWord, Vertex nextWord, Network network) {
-        if (vertex.instanceOf(Primitive.WORD)) {
-            if (!vertex.hasData()) {
-                // Check if it is a newly create compound word that needs the text.
-                if (vertex.instanceOf(Primitive.COMPOUND_WORD)) {
-                    Collection<Relationship> wordParts = vertex.orderedRelationships(Primitive.WORD);
-                    if (wordParts != null) {
-                        StringWriter writer = new StringWriter();
-                        boolean first = true;
-                        for (Relationship wordPart : wordParts) {
-                            if (!first) {
-                                writer.write(" ");
-                            } else {
-                                first = false;
-                            }
-                            writer.write(wordPart.getTarget().getDataValue());
-                        }
-                        return network.createWord(writer.toString());
-                    }
-                }
-            }
-            return vertex;
-        }
-        if (vertex.instanceOf(Primitive.FRAGMENT)) {
-            if (!vertex.hasData()) {
-                return network.createFragment(printFragment(vertex, previousWord, nextWord, network));
-            }
-            return vertex;
-        }
-        if (vertex.instanceOf(Primitive.SENTENCE)) {
-            if (!vertex.hasData()) {
-                return network.createSentence(printFragment(vertex, previousWord, nextWord, network));
-            }
-            return vertex;
-        }
-        if (vertex.instanceOf(Primitive.PARAGRAPH)) {
-            return vertex;
-        }
-        if (vertex.instanceOf(Primitive.ARRAY)) {
-            if (!vertex.hasData()) {
-                // Print the list.
-                Collection<Relationship> values = vertex.orderedRelationships(Primitive.ELEMENT);
-                if (values != null) {
-                    StringWriter writer = new StringWriter();
-                    int index = 0;
-                    for (Relationship value : values) {
-                        if (!value.isInverse()) {
-                            if (index != 0) {
-                                writer.write(", ");
-                                if (index == (values.size() - 1)) {
-                                    writer.write("and ");
-                                }
-                            }
-                            writer.write(getWordFollowing(value.getTarget(), previousWord, nextWord, network).getDataValue());
-                            index++;
-                        }
-                    }
-                    return network.createFragment(writer.toString());
-                } else {
-                    return network.createWord("empty");
-                }
-            }
-        } else if (vertex.instanceOf(Primitive.LIST)) {
-            if (!vertex.hasData()) {
-                // Print the list.
-                Collection<Relationship> values = vertex.orderedRelationships(Primitive.SEQUENCE);
-                if (values != null) {
-                    StringWriter writer = new StringWriter();
-                    int index = 0;
-                    for (Relationship value : values) {
-                        if (!value.isInverse()) {
-                            if (index != 0) {
-                                writer.write(", ");
-                                if (index == (values.size() - 1)) {
-                                    writer.write("and ");
-                                }
-                            }
-                            writer.write(getWordFollowing(value.getTarget(), previousWord, nextWord, network).getDataValue());
-                            index++;
-                        }
-                    }
-                    return network.createFragment(writer.toString());
-                } else {
-                    return network.createWord("empty");
-                }
-            }
-        }
-        // Verb conjugation
-        Vertex tense = null;
-        if (relationship != null && relationship.hasMeta()) {
-            tense = relationship.getMeta().getRelationship(Primitive.TENSE);
-        }
-        Vertex word = null;
-        if (vertex.instanceOf(Primitive.ACTION)) {
-            word = vertex.getAssoiate(network.createVertex(Primitive.WORD),
-                    previousWord, network.createVertex(Primitive.CONJUGATION),
-                    tense, network.createVertex(Primitive.TENSE),
-                    previousWord, network.createVertex(Primitive.PREVIOUS));
-        }
-        if (word == null) {
-            // Pronoun subjuction
-            Collection<Relationship> types = null;
-            if (relationship != null && relationship.hasMeta()) {
-                types = relationship.getMeta().getRelationships(Primitive.TYPE);
-            }
-            if (types == null) {
-                word = vertex.mostConscious(Primitive.NAME);
-            }
-            if (word == null) {
-                // What sounds right
-                if (nextWord != null && !nextWord.instanceOf(Primitive.WORD)) {
-                    word = vertex.getAssoiate(network.createVertex(Primitive.WORD),
-                            previousWord, network.createVertex(Primitive.PREVIOUS),
-                            nextWord.getRelationships(Primitive.WORD), network.createVertex(Primitive.NEXT),
-                            types, network.createVertex(Primitive.TYPE), null);
-                    nextWord = nextWord.getRelationship(Primitive.WORD);
-                } else {
-                    word = vertex.getAssoiate(network.createVertex(Primitive.WORD),
-                            previousWord, network.createVertex(Primitive.PREVIOUS),
-                            nextWord, network.createVertex(Primitive.NEXT),
-                            types, network.createVertex(Primitive.TYPE), null);
-                }
-            }
-        }
-        if (word == null) {
-            word = vertex.mostConscious(Primitive.WORD);
-        }
-        if ((word == null) && (vertex.instanceOf(Primitive.SEQUENCE))) {
-            // TODO assume digits for now, should probably change to sequence
-            List<Relationship> digits = vertex.orderedRelationships(Primitive.DIGIT);
-            if (digits != null) {
-                StringWriter writer = new StringWriter();
-                for (int index = digits.size() - 1; index >= 0; index--) {
-                    Relationship digit = digits.get(index);
-                    writer.write(String.valueOf(digit.getTarget().getData()));
-                }
-                word = network.createWord(writer.toString());
-            }
-        }
-        if (word == null) {
-            if (!vertex.hasData()) {
-                word = vertex.mostConscious(Primitive.SENTENCE);
-                if (word != null) {
-                    return word;
-                }
-                // If no word, call it what it is.
-                Collection<Relationship> classifications = vertex.getRelationships(Primitive.INSTANTIATION);
-                if (classifications != null) {
-                    Vertex mostSpecialized = null;
-                    for (Relationship classification : classifications) {
-                        if (mostSpecialized == null) {
-                            mostSpecialized = classification.getTarget();
-                        } else if (classification.getTarget().hasRelationship(Primitive.SPECIALIZATION, mostSpecialized)) {
-                            mostSpecialized = classification.getTarget();
-                        }
-                    }
-                    word = mostSpecialized.mostConscious(Primitive.WORD);
-                }
-                if (word == null) {
-                    word = network.createVertex("");
-                }
-            } else if (vertex.isPrimitive()) {
-                word = network.createWord(vertex.getDataValue());
-            } else if (vertex.getData() instanceof Time) {
-                word = network.createWord(Utils.printTime((Time)vertex.getData(), "h:mm:ss a z"));
-            } else {
-                word = network.createFragment(vertex.getDataValue());
-            }
-        }
-        return word;
-    }
-
-    public static String printFragment(Vertex fragment, Vertex previousWord, Vertex nextWord, Network network) {
-        List<Relationship> values = fragment.orderedRelationships(Primitive.WORD);
-        StringWriter writer = new StringWriter();
-        int index = 0;
-        if (values != null) {
-            for (Relationship value : values) {
-                if (index != 0) {
-                    writer.write(" ");
-                }
-                Vertex next = nextWord;
-                if (index < values.size()) {
-                    next = values.get(index).getTarget();
-                }
-                Vertex word = getWordFollowing(value.getTarget(), previousWord, next, network);
-                writer.write(word.printString());
-                index++;
-                previousWord = word;
-            }
-        }
-        return writer.toString();
-    }
-
-    public Vertex getLastStateMachine(Network network) {
-        if (this.lastStateMachineId == null) {
-            return null;
-        }
-        return network.findById(this.lastStateMachineId);
-    }
-
-    public void setLastStateMachine(Vertex lastStateMachine) {
-        if (lastStateMachine == null) {
-            this.lastStateMachineId = null;
-        } else {
-            this.lastStateMachineId = lastStateMachine.getId();
-        }
-    }
-
-    public Vertex getLastState(Network network) {
-        if (this.lastStateId == null) {
-            return null;
-        }
-        return network.findById(this.lastStateId);
-    }
-
-    public void setLastState(Vertex lastState) {
-        if (lastState == null) {
-            this.lastStateId = null;
-        } else {
-            this.lastStateId = lastState.getId();
-        }
-    }
-
-    public Vertex getLastQuotient(Network network) {
-        if (this.lastQuotientId == null) {
-            return null;
-        }
-        return network.findById(this.lastQuotientId);
-    }
-
-    public void setLastQuotient(Vertex lastQuotient) {
-        if (lastQuotient == null) {
-            this.lastQuotientId = null;
-        } else {
-            this.lastQuotientId = lastQuotient.getId();
-        }
-    }
-
-    public boolean getEnableEmote() {
-        return enableEmote;
-    }
-
-    public void setEnableEmote(boolean enableEmote) {
-        this.enableEmote = enableEmote;
-    }
-
-    public String getLanguage() {
-        return language;
-    }
-
-    public void setLanguage(String language) {
-        this.language = language;
-    }
-
-    /**
-     * Load, compile, and add the state machine from the .self file.
-     */
-    public void loadSelfFile(File file, String encoding, boolean debug) {
-        try {
-            loadSelfFile(new FileInputStream(file), encoding, MAX_FILE_SIZE, debug, true);
-        } catch (IOException exception) {
-            throw new SelfParseException("Parsing error occurred", exception);
-        }
-    }
-
-    /**
-     * Load, compile, and add the state machine from the .self file.
-     */
-    public void loadSelfFile(URL url, String encoding, boolean debug) {
-        try {
-            loadSelfFile(Utils.openStream(url), encoding, MAX_FILE_SIZE, debug, true);
-        } catch (IOException exception) {
-            throw new SelfParseException("Parsing error occurred", exception);
-        }
-    }
-
-    /**
-     * Load, compile, and add the state machine from the .self file stream.
-     */
-    public void loadSelfFile(InputStream stream, String encoding, int maxSize, boolean debug, boolean optimize) {
-        Network network = getBot().memory().newMemory();
-        Vertex language = network.createVertex(getPrimitive());
-        SelfCompiler compiler = SelfCompiler.getCompiler();
-        if (!optimize) {
-            compiler = new SelfCompiler();
-        }
-        Vertex stateMachine = compiler.parseStateMachine(stream, debug, network, encoding, maxSize);
-        SelfCompiler.getCompiler().pin(stateMachine);
-        language.addRelationship(Primitive.STATE, stateMachine);
-        network.save();
-    }
-
-    /**
-     * Load, parse, the aiml file as a chat log.
-     */
-    public void loadAIMLFileAsLog(File file, String encoding, boolean pin) {
-        try {
-            loadAIMLFileAsLog(new FileInputStream(file), encoding, MAX_FILE_SIZE, pin);
-        } catch (IOException exception) {
-            throw new SelfParseException("Parsing error occurred", exception);
-        }
-    }
-
-    /**
-     * Load, parse, the aiml file as a script.
-     */
-    public void loadAIMLFile(File file, boolean createStates, boolean indexStatic, String encoding) {
-        try {
-            loadAIMLFile(new FileInputStream(file), file.getName(), createStates, false, indexStatic, encoding, MAX_FILE_SIZE);
-        } catch (IOException exception) {
-            throw new SelfParseException("Parsing error occurred", exception);
-        }
-    }
-
-    /**
-     * Load, parse, the aiml file as a chat log.
-     */
-    public void loadAIMLFileAsLog(InputStream stream, String encoding, int maxSize, boolean pin) {
-        String text = Utils.loadTextFile(stream, encoding, MAX_FILE_SIZE);
-        loadAIMLAsLog(text, pin);
-    }
-
-    /**
-     * Load, parse, the aiml as a chat log.
-     */
-    public void loadAIMLAsLog(String text, boolean pin) {
-        long start = System.currentTimeMillis();
-        Network network = getBot().memory().newMemory();
-        AIMLParser.parser().parseAIML(text, false, false, pin, false, null, network);
-        network.save();
-        log("AIML parsing time", Level.INFO, System.currentTimeMillis() - start);
-    }
-
-    /**
-     * Load, parse, the aiml file as a state machine.
-     */
-    public void loadAIMLFile(InputStream stream, String name, boolean createStates, boolean mergeState, boolean indexStatic, String encoding, int maxSize) {
-        String text = Utils.loadTextFile(stream, encoding, MAX_FILE_SIZE);
-        loadAIML(text, name, createStates, mergeState, indexStatic);
-    }
-
-    /**
-     * Load, parse, the aiml file as a state machine.
-     */
-    public void loadAIML(String text, String name, boolean createStates, boolean mergeState, boolean indexStatic) {
-        long start = System.currentTimeMillis();
-        Network network = getBot().memory().newMemory();
-        Vertex stateMachine = null;
-        Vertex language = network.createVertex(getPrimitive());
-        if (mergeState) {
-            stateMachine = language.lastRelationship(Primitive.STATE);
-        }
-        if (stateMachine == null) {
-            stateMachine = network.createInstance(Primitive.STATE);
-            stateMachine.addRelationship(Primitive.LANGUAGE, network.createVertex(Primitive.AIML));
-            stateMachine.addRelationship(Primitive.LANGUAGE, network.createVertex(Primitive.SELF4));
-            stateMachine.setName(name);
-            language.addRelationship(Primitive.STATE, stateMachine);
-            // Avoid setting source code to reduce file size.
-			/*TextData data = new TextData();
-			data.setText(text);
-			stateMachine.addRelationship(Primitive.SOURCECODE, network.createVertex(data));
-			Vertex sourceCode = stateMachine.getRelationship(Primitive.SOURCECODE);
-			if (sourceCode != null) {
-				sourceCode.setPinned(true);
-			}*/
-        }
-        stateMachine = AIMLParser.parser().parseAIML(text, true, createStates, false, indexStatic, stateMachine, network);
-        SelfCompiler.getCompiler().pin(stateMachine);
-        network.save();
-        log("AIML parsing time", Level.INFO, System.currentTimeMillis() - start);
-    }
-}
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/resources/base/layout/activity_chat.xml b/BotLibreOffline/entry/src/main/resources/base/layout/activity_chat.xml
index 48c81b0f258cc7c34fbb3c5afde58c0453ac155d..379dc9df7f3bdbbf35f45349a84cc82aad2e8c9c 100644
--- a/BotLibreOffline/entry/src/main/resources/base/layout/activity_chat.xml
+++ b/BotLibreOffline/entry/src/main/resources/base/layout/activity_chat.xml
@@ -1,7 +1,7 @@
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/BotLibreOffline/entry/src/main/resources/base/layout/activity_chat2.xml b/BotLibreOffline/entry/src/main/resources/base/layout/activity_chat2.xml
index 53b7176f4cf648434b88a03a500abee5e943757c..c26e6c67fc212aedfd4f64ab756b790d2e9adaa6 100644
--- a/BotLibreOffline/entry/src/main/resources/base/layout/activity_chat2.xml
+++ b/BotLibreOffline/entry/src/main/resources/base/layout/activity_chat2.xml
@@ -1,7 +1,7 @@
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/PizzaBotOffline/CHANGELOG.md b/PizzaBotOffline/CHANGELOG.md
index 6ec1235eca7563f9dd8057334ecaf1b219b0abcc..4a3828396356ad9e90deacb3d088c9947a14671d 100644
--- a/PizzaBotOffline/CHANGELOG.md
+++ b/PizzaBotOffline/CHANGELOG.md
@@ -3,4 +3,4 @@ ohos 第二个版本，更新sdk6
 ## 0.0.1-SNAPSHOT
 ohos 第一个版本
  * 实现了原库的全部api
- * 软键盘关闭后无法恢复页面布局
\ No newline at end of file
+ * 鸿蒙监听不到软键盘软键盘状态的改变，因此软键盘关闭后无法恢复页面布局
\ No newline at end of file
diff --git a/PizzaBotOffline/README.md b/PizzaBotOffline/README.md
index 59bb87c380baf819dd68bf34eb47cd968d69dc1a..0f227d82ed7c41531a06e314fbfb3657ffc1cd68 100644
--- a/PizzaBotOffline/README.md
+++ b/PizzaBotOffline/README.md
@@ -6,10 +6,10 @@
 - 项目名称：BotLibre
 - 所属系列：OpenHarmony的第三方组件适配移植
 - 功能：人工智能、nlp、聊天机器人、虚拟代理、社交媒体自动化和实时聊天自动化的开源平台
-- 基线版本：master
 - 项目移植状态：主功能完成
 - 调用差异：无
 - 开发版本：sdk6，DevEco Studio2.2 Beta1
+- 基线版本：master
 
 ## 效果演示
 
@@ -24,7 +24,7 @@ Demo中调用library组件，然后通过五个功能操作展示组件。
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/PizzaBotOffline/build.gradle b/PizzaBotOffline/build.gradle
index a4bbee50c84428507c792bf978676f0ff6fe17a8..67d49592dcd4742b75d4224a203792ed526f9919 100644
--- a/PizzaBotOffline/build.gradle
+++ b/PizzaBotOffline/build.gradle
@@ -2,6 +2,17 @@
 apply plugin: 'com.huawei.ohos.app'
 
 ohos {
+    signingConfigs {
+        debug {
+            storeFile file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_890086000102149657.p12')
+            storePassword '00000018FAA8E56771F402F726A8F9ECFCDBED9410306E156CD40D3412F2B82EC10270A42BF9E2D8'
+            keyAlias = 'debugKey'
+            keyPassword '00000018A082968AEC078212AB26B390BB301376468E26D511F7A32B95CB39EBD084DF7856F7A893'
+            signAlg = 'SHA256withECDSA'
+            profile file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_sdk_890086000102149657.p7b')
+            certpath file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_890086000102149657.cer')
+        }
+    }
     compileSdkVersion 6
     defaultConfig {
         compatibleSdkVersion 5
diff --git a/PizzaBotOffline/entry/src/main/config.json b/PizzaBotOffline/entry/src/main/config.json
index e66868b552b6a2fb6411b0443470101d89f000f9..2828ce9e7926dacdcd184cfa03e675f48c55dc3d 100644
--- a/PizzaBotOffline/entry/src/main/config.json
+++ b/PizzaBotOffline/entry/src/main/config.json
@@ -40,38 +40,38 @@
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.avatar.AvatarSelection",
+        "name": "org.botlibre.sdk.ability.avatar.AvatarSelection",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.LoginAbility",
+        "name": "org.botlibre.sdk.ability.LoginAbility",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.CreateUserAbility",
+        "name": "org.botlibre.sdk.ability.CreateUserAbility",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.ChatAbility",
+        "name": "org.botlibre.sdk.ability.ChatAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.MicConfigAbility",
+        "name": "org.botlibre.sdk.ability.MicConfigAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.LibreAbility",
+        "name": "org.botlibre.sdk.ability.LibreAbility",
         "description": "",
         "type": "page"
       }
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/BotLibreForBusinessCredentials.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/BotLibreForBusinessCredentials.java
deleted file mode 100644
index 14163f333a7eb8e72c1ed8c949d5c491da956106..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/BotLibreForBusinessCredentials.java
+++ /dev/null
@@ -1,36 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk;
-
-/**
- * Credentials for use with hosted services on the Bot Libre for Business website,
- * a commercial bot, live chat, chatroom, and forum hosting service.
- * https://www.botlibre.biz
- */
-public class BotLibreForBusinessCredentials extends Credentials {
-	public static String DOMAIN = "www.botlibre.biz";
-	//public static String DOMAIN = "192.168.0.11:9080";
-	public static String APP = "";
-	//public static String APP = "/livechat";
-	public static String PATH = "/rest/api";
-
-	public BotLibreForBusinessCredentials(String applicationId) {
-		this.host = DOMAIN;
-		this.app = APP;
-		this.url = "https://" + DOMAIN + APP + PATH;
-		this.applicationId = applicationId;
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/Credentials.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/Credentials.java
index 9fd1657009cb2fbb47c72256b2a177ee10d6dc35..56ded40ef597b5fc0f887de75b8093ad596d8408 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/Credentials.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/Credentials.java
@@ -16,76 +16,65 @@
 package org.botlibre.sdk;
 
 /**
- * Credential used to establish a connection.
- * Requires the url, and an application id.
- * You can obtain your application id from your user details page on the hosting website.
+ * Credentials
+ *
+ * @since 2021-04-16
  */
 public class Credentials {
-	public String host = "";
-	public String app = "";
-	public String url = "";
-	/**
-	 * Your application's unique identifier.
-	 * You can obtain your application id from your user details page on the hosting website.
-	 */
-	public String applicationId = "";
-
-	public Credentials() {
-	}
-
-	/**
-	 * Creates a new credentials for the service host url, and the application id.
-	 */
-	public Credentials(String url, String applicationId) {
-		this.url = url;
-		this.applicationId = applicationId;
-	}
+    /**
+     * host
+     */
+    public String host = "";
+    /**
+     * host
+     */
+    public String app = "";
+    /**
+     * host
+     */
+    public String url = "";
+    /**
+     * Your application's unique identifier.
+     * You can obtain your application id from your user details page on the hosting website.
+     */
+    public String applicationId = "";
 
-	public String getUrl() {
-		return url;
-	}
-	
-	/**
-	 * Sets the hosted service server url, i.e. http://www.paphuslivechat.com
-	 */
-	public void setUrl(String url) {
-		this.url = url;
-	}
+    /**
+     * host
+     */
+    public Credentials() {
+    }
 
-	public String getHost() {
-		return host;
-	}
+    /**
+     * setHost
+     *
+     * @param host
+     */
+    public void setHost(String host) {
+        this.host = host;
+    }
 
-	/**
-	 * Sets the server host name, i.e. www.paphuslivechat.com
-	 */
-	public void setHost(String host) {
-		this.host = host;
-	}
+    public String getApp() {
+        return app;
+    }
 
-	public String getApp() {
-		return app;
-	}
+    /**
+     * setApp
+     *
+     * @param app
+     */
+    public void setApp(String app) {
+        this.app = app;
+    }
 
-	/**
-	 * Sets an app url postfix, this is normally not required, i.e. "".
-	 */
-	public void setApp(String app) {
-		this.app = app;
-	}
+    /**
+     * Returns your application's unique identifier.
+     *
+     * @return applicationId
+     */
+    public String getApplicationId() {
+        return applicationId;
+    }
 
-	/**
-	 * Returns your application's unique identifier.
-	 */
-	public String getApplicationId() {
-		return applicationId;
-	}
 
-	/**
-	 * Sets your application's unique identifier.
-	 * You can obtain your application id from your user details page on the hosting website.
-	 */
-	public void setApplicationId(String applicationId) {
-		this.applicationId = applicationId;
-	}
 }
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/FORUMSlibreCredentials.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/FORUMSlibreCredentials.java
deleted file mode 100644
index 3640407f9314d4facd89dc83ac38ecb577ce7208..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/FORUMSlibreCredentials.java
+++ /dev/null
@@ -1,35 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk;
-
-/**
- * Credentials for use with hosted services on the FORUMS libre website, a free embeddable forum hosting service.
- * http://www.forumslibre.com
- */
-public class FORUMSlibreCredentials extends Credentials {
-	public static String DOMAIN = "www.forumslibre.com";
-	//public static String DOMAIN = "192.168.0.15:9080";
-	public static String APP = "";
-	//public static String APP = "/forumslibre";
-	public static String PATH = "/rest/api";
-
-	public FORUMSlibreCredentials(String applicationId) {
-		this.host = DOMAIN;
-		this.app = APP;
-		this.url = "http://" + DOMAIN + APP + PATH;
-		this.applicationId = applicationId;
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LIVECHATlibreCredentials.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LIVECHATlibreCredentials.java
deleted file mode 100644
index 950827b2e524b6a5b3eeac39bdef86f5bf690ba4..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LIVECHATlibreCredentials.java
+++ /dev/null
@@ -1,35 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk;
-
-/**
- * Credentials for use with hosted services on the LIVE CHAT libre website, a free live chat, chatrooms, forum, and chat bots that learn.
- * http://www.livechatlibre.com
- */
-public class LIVECHATlibreCredentials extends Credentials {
-	public static String DOMAIN = "www.livechatlibre.com";
-	//public static String DOMAIN = "192.168.0.12:9080";
-	public static String APP = "";
-	//public static String APP = "/livechatlibre";
-	public static String PATH = "/rest/api";
-
-	public LIVECHATlibreCredentials(String applicationId) {
-		this.host = DOMAIN;
-		this.app = APP;
-		this.url = "http://" + DOMAIN + APP + PATH;
-		this.applicationId = applicationId;
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
deleted file mode 100644
index 2fb6870bdbd240776a2b85013833826dc8f2e309..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
+++ /dev/null
@@ -1,290 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk;
-
-import org.botlibre.sdk.config.ChannelConfig;
-import org.botlibre.sdk.config.UserConfig;
-
-import de.tavendo.autobahn.WebSocketConnection;
-import de.tavendo.autobahn.WebSocketConnectionHandler;
-
-/**
- * Connection class for a Live Chat, or chatroom connection.
- * A live chat connection is different than an SDKConnection as it is asynchronous,
- * and uses web sockets for communication.
- */
-public class LiveChatConnection {
-	protected boolean debug = false;
-	protected ChannelConfig channel;
-	protected UserConfig user;
-	protected Credentials credentials;
-    protected WebSocketConnection socket;
-    protected LiveChatListener listener;
-    protected boolean keepAlive = false;
-    protected Thread keepAliveThread;
-	
-    /**
-     * Create a new connection with the application credentials and the listener.
-     * The listener will be notified asynchronously of messages and events.
-     */
-	public LiveChatConnection(Credentials credentials, LiveChatListener listener) {
-		this.credentials = credentials;
-		this.listener = listener;
-	}
-	
-	/**
-	 * Connection to the live chat server channel.
-	 * Validate the user credentials.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void connect(ChannelConfig channel, UserConfig user) {
-		this.channel = channel;
-		this.user = user;
-		try {
-			this.socket = new WebSocketConnection();
-			this.socket.connect("ws://" + this.credentials.host + this.credentials.app
-						+ "/live/chat", new WebSocketConnectionHandler() {
-				@Override
-				public void onOpen() {
-					if (LiveChatConnection.this.user == null) {
-						LiveChatConnection.this.socket.sendTextMessage("connect " + LiveChatConnection.this.channel.id + " " + LiveChatConnection.this.credentials.applicationId);
-					} else {
-						LiveChatConnection.this.socket.sendTextMessage(
-								"connect " + LiveChatConnection.this.channel.id + " " + LiveChatConnection.this.user.user
-								+ " " + LiveChatConnection.this.user.token + " " + LiveChatConnection.this.credentials.applicationId);						
-					}
-				}
-
-				@Override
-				public void onTextMessage(String text) {
-			    	String user = "";
-			    	String message = text;
-			    	int index = text.indexOf(':');
-			    	if (index != -1) {
-			    		user = text.substring(0, index);
-			    		message = text.substring(index + 2, text.length());
-			    	}
-					if (user.equals("Online-xml")) {
-						return;
-					}
-					if (user.equals("Online")) {
-						LiveChatConnection.this.listener.updateUsers(message);
-						return;
-					}
-					
-					if (LiveChatConnection.this.keepAlive && user.equals("Info") && text.contains("pong")) {
-						return;
-					}
-					if (user.equals("Info")) {
-						LiveChatConnection.this.listener.info(text);
-						return;
-					}
-					if (user.equals("Error")) {
-						LiveChatConnection.this.listener.error(text);
-						return;
-					}
-					LiveChatConnection.this.listener.message(text);
-				}
-
-				@Override
-				public void onClose(int code, String reason) {
-					LiveChatConnection.this.listener.message("Info: Closed");
-					LiveChatConnection.this.listener.closed();
-				}
-			});
-		} catch (Exception exception) {
-			throw new SDKException(exception);
-		}
-	}
-
-	/**
-	 * Sent a text message to the channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 * Note, the listener will receive its own messages.
-	 */
-	public void sendMessage(String message) {
-		checkSocket();
-		if (message == null) {
-			return;
-		}
-		this.socket.sendTextMessage(message);
-	}
-
-	/**
-	 * Accept a private request.
-	 * This is also used by an operator to accept the top of the waiting queue.
-	 * This can also be used by a user to chat with the channel bot.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void accept() {
-		checkSocket();
-		this.socket.sendTextMessage("accept");
-	}
-
-	/**
-	 * Test the connection.
-	 * A pong message will be returned, this message will not be broadcast to the channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void ping() {
-		checkSocket();
-		this.socket.sendTextMessage("ping");
-	}
-
-	/**
-	 * Exit from the current private channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void exit() {
-		checkSocket();
-		this.socket.sendTextMessage("exit");
-	}
-
-	/**
-	 * Request a private chat session with a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void pvt(String user) {
-		checkSocket();
-		this.socket.sendTextMessage("pvt: " + user);
-	}
-
-	/**
-	 * Boot a user from the channel.
-	 * You must be a channel administrator to boot a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void boot(String user) {
-		checkSocket();
-		this.socket.sendTextMessage("boot: " + user);
-	}
-
-	/**
-	 * Send a private message to a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void whisper(String user, String message) {
-		checkSocket();
-		this.socket.sendTextMessage("whisper:" + user + ": " + message);
-	}
-
-	/**
-	 * Disconnect from the channel.
-	 */
-	public void disconnect() {
-    	this.keepAlive = false;
-    	if (this.keepAliveThread != null) {
-    		this.keepAliveThread.interrupt();
-    	}
-    	if (this.socket != null) {
-    		this.socket.disconnect();
-    	}
-	}
- 
-    protected void runKeepAlive() {
-    	this.keepAliveThread = new Thread() {
-    		public void run() {
-    			while (keepAlive) {
-	    			sendMessage("ping");
-	    			try {
-	    				Thread.sleep(600000);
-	    			} catch (InterruptedException exception) {
-	    				return;
-	    			}
-    			}
-    		}
-    	};
-    	this.keepAliveThread.start();
-    }
-    
-    public boolean isDebug() {
-		return debug;
-	}
-
-	/**
-	 * Enable debugging messages (logged to System.out).
-	 */
-	public void setDebug(boolean debug) {
-		this.debug = debug;
-	}
-
-	/**
-	 * Return the current channel.
-	 */
-	public ChannelConfig getChannel() {
-		return channel;
-	}
-
-	protected void setChannel(ChannelConfig channel) {
-		this.channel = channel;
-	}
-
-	/**
-	 * Return the current user.
-	 */
-	public UserConfig getUser() {
-		return user;
-	}
-
-	protected void setUser(UserConfig user) {
-		this.user = user;
-	}
-
-	/**
-	 * Return the current application credentials.
-	 */
-	public Credentials getCredentials() {
-		return credentials;
-	}
-
-	protected void setCredentials(Credentials credentials) {
-		this.credentials = credentials;
-	}
-
-	public LiveChatListener getListener() {
-		return listener;
-	}
-
-	public void setListener(LiveChatListener listener) {
-		this.listener = listener;
-	}
-
-	/**
-	 * Return if the connection will be kept alive, and not allowed to timeout due to inAbility.
-	 */
-	public boolean isKeepAlive() {
-		return keepAlive;
-	}
-
-	/**
-	 * Set if the connection should be kept alive, and not allowed to timeout due to inAbility.
-	 */
-	public void setKeepAlive(boolean keepAlive) {
-		this.keepAlive = keepAlive;
-    	if (this.keepAlive) {
-    		runKeepAlive();
-    	} else if (this.keepAliveThread != null) {
-    		this.keepAliveThread.interrupt();
-    		this.keepAliveThread = null;
-    	}
-    }
-	
-	protected void checkSocket() {
-		if (this.socket == null) {
-			throw new SDKException("Not connected");
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LiveChatListener.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LiveChatListener.java
index 160064a123cdf24b71eb3ca6c407f6206dda4495..9c92ee526cb6ed02df1bb5ffdf8de36ec4d3968c 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LiveChatListener.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/LiveChatListener.java
@@ -22,18 +22,24 @@ package org.botlibre.sdk;
 public interface LiveChatListener {
 	/**
 	 * A user message was received from the channel.
+	 *
+	 * @param message
 	 */
 	void message(String message);
 	
 	/**
 	 * An informational message was received from the channel.
 	 * Such as a new user joined, private request, etc.
+	 *
+	 * @param message
 	 */	
 	void info(String message);
 
 	/**
 	 * An error message was received from the channel.
 	 * This could be an access error, or message failure.
+	 *
+	 * @param message
 	 */	
 	void error(String message);
 	
@@ -46,6 +52,8 @@ public interface LiveChatListener {
 	 * The channels users changed (user joined, left, etc.)
 	 * This contains a comma separated values (CSV) list of the current channel users.
 	 * It can be passed to the SDKConnection.getUsers() API to obtain the UserConfig info for the users.
+	 *
+	 * @param usersCSV
 	 */
 	void updateUsers(String usersCSV);
 }
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/MainAbility.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/MainAbility.java
index 73bb452e7be587abd096f5c95490519dd02e39ca..666bb6eec6bf7df3e066b1359ae83a5193778fc4 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/MainAbility.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/MainAbility.java
@@ -15,39 +15,6 @@
 
 package org.botlibre.sdk;
 
-import org.botlibre.sdk.activityy.actions.HttpFetchActionOffline;
-import org.botlibre.sdk.activityy.actions.HttpGetImageAction;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.dialog.SpinnerDialogBuilder;
-import org.botlibre.sdk.activityy.listener.LanguageListener;
-import org.botlibre.sdk.activityy.listener.SelectListener;
-import org.botlibre.sdk.activityy.CreateUserAbility;
-import org.botlibre.sdk.activityy.LibreAbility;
-import org.botlibre.sdk.activityy.ListTemplateView;
-import org.botlibre.sdk.activityy.LoginAbility;
-import org.botlibre.sdk.activityy.avatar.AvatarSelection;
-import org.botlibre.sdk.activityy.dialog.LanguageDialogBuilder;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.AvatarMedia;
-import org.botlibre.sdk.config.BotModeConfig;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ChannelConfig;
-import org.botlibre.sdk.config.DomainConfig;
-import org.botlibre.sdk.config.ForumConfig;
-import org.botlibre.sdk.config.ForumPostConfig;
-import org.botlibre.sdk.config.GraphicConfig;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.IssueConfig;
-import org.botlibre.sdk.config.LearningConfig;
-import org.botlibre.sdk.config.OfflineTemplateConfig;
-import org.botlibre.sdk.config.ResponseConfig;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import org.botlibre.sdk.config.UserConfig;
-import org.botlibre.sdk.config.VoiceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.micro.MicroConnection;
-import org.botlibre.sdk.util.PreferencesUtils;
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
 import ohos.aafwk.content.Operation;
@@ -56,7 +23,6 @@ import ohos.agp.components.Component;
 import ohos.agp.components.DirectionalLayout;
 import ohos.agp.components.LayoutScatter;
 import ohos.agp.components.Text;
-import ohos.agp.components.TextField;
 import ohos.agp.utils.LayoutAlignment;
 import ohos.agp.window.dialog.CommonDialog;
 import ohos.agp.window.dialog.IDialog;
@@ -73,8 +39,37 @@ import ohos.media.audio.AudioRemoteException;
 import ohos.security.SystemPermission;
 import ohos.utils.net.Uri;
 import org.botlibre.knowledge.micro.MicroMemory;
+import org.botlibre.sdk.ability.ChatAbility;
+import org.botlibre.sdk.ability.CreateUserAbility;
+import org.botlibre.sdk.ability.LibreAbility;
+import org.botlibre.sdk.ability.ListTemplateView;
+import org.botlibre.sdk.ability.LoginAbility;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.avatar.AvatarSelection;
+import org.botlibre.sdk.ability.dialog.LanguageDialogBuilder;
+import org.botlibre.sdk.ability.dialog.SpinnerDialogBuilder;
+import org.botlibre.sdk.ability.listener.LanguageListener;
+import org.botlibre.sdk.ability.listener.SelectListener;
+import org.botlibre.sdk.config.AvatarConfig;
+import org.botlibre.sdk.config.BrowseConfig;
+import org.botlibre.sdk.config.ChannelConfig;
+import org.botlibre.sdk.config.DomainConfig;
+import org.botlibre.sdk.config.ForumConfig;
+import org.botlibre.sdk.config.ForumPostConfig;
+import org.botlibre.sdk.config.GraphicConfig;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.IssueConfig;
+import org.botlibre.sdk.config.LearningConfig;
+import org.botlibre.sdk.config.OfflineTemplateConfig;
+import org.botlibre.sdk.config.ResponseConfig;
+import org.botlibre.sdk.config.ScriptConfig;
+import org.botlibre.sdk.config.ScriptSourceConfig;
+import org.botlibre.sdk.config.UserConfig;
+import org.botlibre.sdk.config.VoiceConfig;
+import org.botlibre.sdk.config.WebMediumConfig;
+import org.botlibre.sdk.micro.MicroConnection;
+import org.botlibre.sdk.util.PreferencesUtils;
 
-import javax.swing.text.View;
 import java.awt.*;
 import java.io.File;
 import java.util.ArrayList;
@@ -87,8 +82,19 @@ import static ohos.agp.components.Component.HIDE;
 import static ohos.agp.components.Component.VISIBLE;
 import static ohos.bundle.IBundleManager.PERMISSION_GRANTED;
 
+/**
+ * MainAbility
+ *
+ * @since 2021-04-16
+ */
 public class MainAbility extends LibreAbility implements SelectListener, LanguageListener {
+    /**
+     * ADULT
+     */
     public static final boolean DEBUG = false;
+    /**
+     * ADULT
+     */
     public static final boolean ADULT = false;
 
     /**
@@ -107,8 +113,17 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
      * To launch into a specific domain, enter the domain id here.
      */
     public static String domainId = null;
+    /**
+     * domain
+     */
     public static DomainConfig domain;
+    /**
+     * domain
+     */
     public static String defaultType = "Bots";
+    /**
+     * domain
+     */
     public static boolean showAds = true;
 
     /**
@@ -129,24 +144,21 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
-    public static String WEBSITE = "https://www.botlibre.com";
-    public static final String WEBSITEHTTPS = "https://www.botlibre.com";
-    public static String SERVER = "botlibre.com";
-
     /**
      * If you are building a single instance app, then you can set the instance id or name here,
-     * and use this activity to launch it.
      */
     public static String launchInstanceId = ""; // i.e. "171"
+    /**
+     * launchInstanceName
+     */
     public static String launchInstanceName = "Pizza Bot"; // i.e. "Help Bot"
+    /**
+     * website
+     */
     public static String website = "https://www.botlibre.com";
-    public static String prefix = "Bot";
-    public static String launchSelfScriptID = "";
-    public static String launchGreetingScriptID = "";
 
     /**
      * If you are building a single instance app, then you can set the launchType to
-     * have this activity launch the bot, forum, or channel.
      */
     public static LaunchType launchType = LaunchType.Bot;
 
@@ -160,82 +172,169 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         languageselect.setText(select);
     }
 
+    /**
+     * HttpConnectAction
+     *
+     * @since 2021-04-16
+     */
     public enum LaunchType {Browse, Bot, Forum, Channel}
 
+    /**
+     * online
+     */
     public static boolean online = true;
 
+    /**
+     * handsFreeSpeech
+     */
     public static boolean handsFreeSpeech = true;
+    /**
+     * listenInBackground
+     */
     public static boolean listenInBackground = false;
+    /**
+     * micConfig
+     */
     public static boolean micConfig = true;
-
-    // selected image from the listView of the offline Templates bots
+    /**
+     * offlineSelectedImage
+     */
     public static int offlineSelectedImage;
-
-    public static boolean hasRequestAvatar;
+    /**
+     * sound
+     */
     public static boolean sound = true;
+    /**
+     * disableVideo
+     */
     public static boolean disableVideo;
+    /**
+     * webm
+     */
     public static boolean webm = true;
+    /**
+     * hd
+     */
     public static boolean hd;
+    /**
+     * deviceVoice
+     */
     public static boolean deviceVoice;
+    /**
+     * customVoice
+     */
     public static boolean customVoice;
+    /**
+     * translate
+     */
     public static boolean translate;
-
+    /**
+     * offlineSpeech
+     */
     public static boolean offlineSpeech = false;
-
-    public static GraphicConfig gInstance;
+    /**
+     * instance
+     */
     public static WebMediumConfig instance;
+    /**
+     * post
+     */
     public static ForumPostConfig post;
+    /**
+     * issue
+     */
     public static IssueConfig issue;
+    /**
+     * user
+     */
     public static UserConfig user;
+    /**
+     * viewUser
+     */
     public static UserConfig viewUser;
+    /**
+     * type
+     */
     public static String type = "Bots";
-    public static BotModeConfig botMode = new BotModeConfig();
+    /**
+     * voice
+     */
     public static VoiceConfig voice = new VoiceConfig();
+    /**
+     * learning
+     */
     public static LearningConfig learning = new LearningConfig();
-    public static AvatarMedia avatarMedia;
-    public static ResponseConfig response;
+    /**
+     * script
+     */
     public static ScriptSourceConfig script;
+    /**
+     * conversation
+     */
     public static String conversation;
+    /**
+     * template
+     */
     public static String template = "";
-    public static String currentPhotoPath;
-    public static List<InstanceConfig> templates;
+    /**
+     * tags
+     */
     public static Object[] tags;
+    /**
+     * categories
+     */
     public static Object[] categories;
-    public static Object[] forumTags;
-    public static Object[] forumPostTags;
-    public static Object[] forumCategories;
+    /**
+     * channelTags
+     */
     public static Object[] channelTags;
-    public static Object[] channelCategories;
-    public static Object[] avatarTags;
-    public static Object[] scriptTags;
-    public static Object[] scriptCategories;
-    public static Object[] avatarCategories;
+    /**
+     * volume
+     */
     public static int volume;
-
+    /**
+     * contentRating
+     */
     public static String contentRating;
-    public static Object[] domainTags;
-    public static Object[] domainCategories;
-
+    /**
+     * nameOfAvatar
+     */
     public static String nameOfAvatar;
-
-    public static Object[] graphicTags;
-    public static Object[] graphicCategories;
-    public static boolean showImages = true;
-    public static BrowseConfig browse = null;
-    public static BrowseConfig browsePosts = null;
-    public static BrowseConfig browseIssues = null;
+    /**
+     * instances
+     */
     public static List<WebMediumConfig> instances = new ArrayList<WebMediumConfig>();
+    /**
+     * posts
+     */
     public static List<ForumPostConfig> posts = new ArrayList<ForumPostConfig>();
-    public static List<IssueConfig> issues = new ArrayList<IssueConfig>();
-    public static List<AvatarMedia> avatarMedias = new ArrayList<AvatarMedia>();
+    /**
+     * current
+     */
     public static MainAbility current;
+    /**
+     * browsing
+     */
     public static boolean browsing;
+    /**
+     * searching
+     */
     public static boolean searching;
+    /**
+     * searchingPosts
+     */
     public static boolean searchingPosts;
-    public static boolean searchingIssues;
-    public static boolean wasDelete;
+    /**
+     * importingBotScript
+     */
     public static boolean importingBotScript = false;
+    /**
+     * importingBotLog
+     */
     public static boolean importingBotLog = false;
+    /**
+     * languages
+     */
     public static String[] languages = new String[]{
             "Default",
             "af - Afrikaans", "sq - Albanian", "ar - Arabic", "hy - Armenian", "az - Azerbaijani",
@@ -249,278 +348,98 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             "tl - Tagalog", "tg - Tajik", "ta - Tamil", "tt - Tatar", "th - Thai", "tr - Turkish",
             "udm - Udmurt", "uk - Ukrainian", "ur - Urdu", "uz - Uzbek", "vi - Vietnamese", "cy - Welsh"
     };
+    /**
+     * servers
+     */
     public static String[] servers = new String[]{"www.botlibre.com", "twitter.botlibre.com", "www.botlibre.biz", "www.livechatlibre.com", "www.forumslibre.com"};
+    /**
+     * servers
+     */
     public static String[] types = new String[]{"Bots", "Avatars", "Scripts", "Forums", "Live Chat", "Graphics", "Domains", "Chat Bot Wars"};
-    public static String[] channelTypes = new String[]{"ChatRoom", "OneOnOne"};
-    public static String[] priorities = new String[]{"Low", "Medium", "High", "Sever"};
-    public static String[] accessModes = new String[]{"Everyone", "Users", "Members", "Administrators"};
-    public static String[] contentRatings = new String[]{"Everyone", "Teen", "Mature"};
-    public static String[] forkAccMode = new String[]{"Administrators", "Members", "Users", "Disabled"};
-    public static String[] mediaAccessModes = new String[]{"Administrators", "Everyone", "Members", "Users", "Disabled"};
-    public static String[] learningModes = new String[]{"Disabled", "Administrators", "Users", "Everyone"};
-    public static String[] correctionModes = new String[]{"Disabled", "Administrators", "Users", "Everyone"};
-    public static String[] scriptLanguages = new String[]{"Self", "AIML", "Response List", "Chat Log", "CVS"};
-    public static String[] botModes = new String[]{"ListenOnly", "AnswerOnly", "AnswerAndListen"};
-    public static String[] responseTypes = new String[]{"conversations", "responses", "greetings", "default", "flagged"};
-    public static String[] durations = new String[]{"all", "day", "week", "month"};
-    public static String[] inputTypes = new String[]{"all", "chat", "tweet", "post", "directmessage", "email"};
-    public static String[] responseRestrictions = new String[]{"", "exact", "keyword", "required", "topic", "label", "previous",
-            "repeat", "missing-keyword", "missing-required", "missing-topic", "patterns", "templates", "flagged", "corrections",
-            "emotions", "actions", "poses"};
-    public static String[] voices = new String[]{
-            "cmu-slt",
-            "cmu-slt-hsmm",
-            "cmu-bdl-hsmm",
-            "cmu-rms-hsmm",
-            "dfki-prudence",
-            "dfki-prudence-hsmm",
-            "dfki-spike",
-            "dfki-spike-hsmm",
-            "dfki-obadiah",
-            "dfki-obadiah-hsmm",
-            "dfki-poppy",
-            "dfki-poppy-hsmm",
-            "bits1-hsmm",
-            "bits3",
-            "bits3-hsmm",
-            "dfki-pavoque-neutral-hsmm",
-            "camille",
-            "camille-hsmm-hsmm",
-            "jessica_voice-hsmm",
-            "pierre-voice-hsmm",
-            "enst-dennys-hsmm",
-            "istc-lucia-hsmm",
-            "voxforge-ru-nsh",
-            "dfki-ot",
-            "dfki-ot-hsmm",
-            "cmu-nk",
-            "cmu-nk-hsmm"
-    };
-    public static String[] voiceMods = new String[]{
-            "default", "child", "whisper", "echo", "robot"
-    };
-    public static String[] voiceNames = new String[]{
-            "English : US : Female : SLT",
-            "English : US : Female : SLT (hsmm)",
-            "English : US : Male : BDL (hsmm)",
-            "English : US : Male : RMS (hsmm)",
-            "English : GB : Female : Prudence",
-            "English : GB : Female : Prudence (hsmm)",
-            "English : GB : Male : Spike",
-            "English : GB : Male : Spike (hsmm)",
-            "English : GB : Male : Obadiah",
-            "English : GB : Male : Obadiah (hsmm)",
-            "English : GB : Female : Poppy",
-            "English : GB : Female : Poppy (hsmm)",
-            "German : DE : Female : Bits1 (hsmm)",
-            "German : DE : Male : Bits3",
-            "German : DE : Male : Bits3 (hsmm)",
-            "German : DE : Male : Pavoque (hsmm)",
-            "French : FR : Female : Camille",
-            "French : FR : Female : Camille (hsmm)",
-            "French : FR : Female : Jessica (hsmm)",
-            "French : FR : Male : Pierre (hsmm)",
-            "French : FR : Male : Dennys (hsmm)",
-            "Italian : IT : Male : Lucia (hsmm)",
-            "Russian : RU : Male : NSH (hsmm)",
-            "Turkish : TR : Male : OT",
-            "Turkish : TR : Male : OT (hsmm)",
-            "Telugu : TE : Female : NK",
-            "Telugu : TE : Female : NK (hsmm)"
-    };
 
     Menu menu;
+    /**
+     * templateID
+     */
     public static int templateID;
+    /**
+     * spin
+     */
     public Button spin;
+    /**
+     * createInstanceButton
+     */
     public Button createInstanceButton;
+    /**
+     * browseButton
+     */
     public Button browseButton;
+    /**
+     * menuButton
+     */
     public Button menuButton;
+    /**
+     * loginButton
+     */
     public Button loginButton;
+    /**
+     * chatButton
+     */
     public Button chatButton;
+    /**
+     * logoutButton
+     */
     public Button logoutButton;
+    /**
+     * viewUserButton
+     */
     public Button viewUserButton;
+    /**
+     * helpButton
+     */
     public Button helpButton;
 
-//    //    @TargetApi(Build.VERSION_CODES.KITKAT)
-////    @SuppressLint("NewApi")
-//    public static String getFilePathFromURI(Context context, Uri uri) {
-//        // DocumentProvider
-//        if (DocumentsContract.isDocumentUri(context, uri)) {
-//
-//            // ExternalStorageProvider
-//            if (isExternalStorageDocument(uri)) {
-//                final String docId = DocumentsContract.getDocumentId(uri);
-//                final String[] split = docId.split(":");
-//                final String type = split[0];
-//
-//                if ("primary".equalsIgnoreCase(type)) {
-//                    return Environment.getExternalStorageDirectory() + "/" + split[1];
-//                }
-//                // TODO handle non-primary volumes
-//            }
-//            // DownloadsProvider
-//            else if (isDownloadsDocument(uri)) {
-//                final String id = DocumentsContract.getDocumentId(uri);
-//                final Uri contentUri = ContentUris.withAppendedId(Uri.parse("content://downloads/public_downloads"),
-//                        Long.valueOf(id));
-//                return getDataColumn(context, contentUri, null, null);
-//            }
-//            // MediaProvider
-//            else if (isMediaDocument(uri)) {
-//                final String docId = DocumentsContract.getDocumentId(uri);
-//                final String[] split = docId.split(":");
-//                final String type = split[0];
-//                Uri contentUri = null;
-//                if ("image".equals(type)) {
-//                    contentUri = MediaStore.Images.Media.EXTERNAL_CONTENT_URI;
-//                } else if ("video".equals(type)) {
-//                    contentUri = MediaStore.Video.Media.EXTERNAL_CONTENT_URI;
-//
-//                } else if ("audio".equals(type)) {
-//                    contentUri = MediaStore.Audio.Media.EXTERNAL_CONTENT_URI;
-//                }
-//                final String selection = "_id=?";
-//                final String[] selectionArgs = new String[]{split[1]};
-//                return getDataColumn(context, contentUri, selection, selectionArgs);
-//            }
-//        }
-//        // MediaStore (and general)
-//        else if ("content".equalsIgnoreCase(uri.getScheme())) {
-//            // Return the remote address
-//            if (isGooglePhotosUri(uri))
-//                return uri.getLastPathSegment();
-//            return getDataColumn(context, uri, null, null);
-//        }
-//        // File
-//        else if ("file".equalsIgnoreCase(uri.getScheme())) {
-//            return uri.getPath();
-//        }
-//        return null;
-//    }
-
-    public static String getDataColumn(Context context, Uri uri, String selection, String[] selectionArgs) {
-//        Cursor cursor = null;
-//        final String column = "_data";
-//        final String[] projection = {column};
-//        try {
-//            cursor = context.getContentResolver().query(uri, projection, selection, selectionArgs, null);
-//            if (cursor != null && cursor.moveToFirst()) {
-//                final int index = cursor.getColumnIndexOrThrow(column);
-//                return cursor.getString(index);
-//            }
-//        } finally {
-//            if (cursor != null)
-//                cursor.close();
-//        }
-        return null;
-    }
-
-    public static Boolean getFileSize(String q, Context a) {
-        if (q == null || q.equals("")) {
+    /**
+     * reInitialize
+     *
+     * @param qq
+     * @param aa
+     * @return true
+     */
+    public static Boolean getFileSize(String qq, Context aa) {
+        if (qq == null || qq.equals("")) {
             return true;
         }
-        File file = new File(q);
+        File file = new File(qq);
         long fileSizeInBytes = file.length();
         long fileSizeInKB = fileSizeInBytes / 1024;
         long fileSizeInMB = fileSizeInKB / 1024;
         if (fileSizeInMB >= 5) {
-            showMessage("The file exceeded the maximum size limit!", (Ability) a);
+            showMessage("The file exceeded the maximum size limit!", (Ability) aa);
             return false;
         } else {
             return true;
         }
     }
 
-    public static boolean isExternalStorageDocument(Uri uri) {
-        return "com.ohos.externalstorage.documents".equals(uri.getDecodedAuthority());
-    }
-
-    /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is DownloadsProvider.
-     */
-    public static boolean isDownloadsDocument(Uri uri) {
-        return "com.ohos.providers.downloads.documents".equals(uri.getDecodedAuthority());
-    }
-
-    /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is MediaProvider.
-     */
-    public static boolean isMediaDocument(Uri uri) {
-        return "com.ohos.providers.media.documents".equals(uri.getDecodedAuthority());
-    }
-
     /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is Google Photos.
+     * reInitialize
+     *
+     * @param context
+     * @return true
      */
-
-    public static boolean isGooglePhotosUri(Uri uri) {
-        return "com.google.ohos.apps.photos.content".equals(uri.getDecodedAuthority());
-    }
-
-    public static String getFileNameFromPath(String path) {
-        int index = path.lastIndexOf("/");
-        return path.substring(index + 1, path.length());
-    }
-
-//    public static String getFileTypeFromPath(String path) {
-//        int index = path.lastIndexOf(".");
-//        String ext = path.substring(index + 1, path.length());
-//        if (ext.equalsIgnoreCase("webm")) {
-//            return "video/webm";
-//        }
-//        return MimeTypeMap.getSingleton().getMimeTypeFromExtension(ext);
-//    }
-
     public static boolean isTablet(Context context) {
-//        return (context.getResourceManager().getConfiguration().isLayoutRTL
-//                & Configuration.AUTO_MODE) >= Configuration.AUTO_MODE;
         return true;
     }
 
-    @SuppressWarnings("rawtypes")
-    public static Class getActivity(WebMediumConfig config) {
-        if (config instanceof ChannelConfig) {
-//            return ChannelAbility.class; //====================
-        } else if (config instanceof ForumConfig) {
-//            return ForumAbility.class; //====================
-        } else if (config instanceof InstanceConfig) {
-//            return BotAbility.class; //====================
-        } else if (config instanceof DomainConfig) {
-//            return DomainAbility.class; //====================
-        } else if (config instanceof AvatarConfig) {
-//            return AvatarAbility.class; //====================
-        } else if (config instanceof ScriptConfig) {
-//            return ScriptAbility.class; //====================
-        } else if (config instanceof GraphicConfig) {
-//            return GraphicAbility.class; //====================
-        }
-        return null;
-    }
-
-    public static void error(String message, Exception exception, Ability activity) {
-        try {
-            if (DEBUG) {
-                System.out.println(String.valueOf(message));
-                if (exception != null) {
-                    exception.printStackTrace();
-                }
-            }
-            if (message == null) {
-                message = "";
-            }
-            if (message.contains("<html>")) {
-                message = "Server Error, ensure you are connected to the Internet";
-            }
-            MainAbility.showMessage(message, activity);
-        } catch (Throwable error) {
-            error.printStackTrace();
-        }
-    }
-
-    public static void errorInfo(int type,String message, Exception exception, Ability activity) {
+    /**
+     * reInitialize
+     *
+     * @param message
+     * @param exception
+     * @param ability
+     */
+    public static void error(String message, Exception exception, Ability ability) {
         try {
             if (DEBUG) {
                 System.out.println(String.valueOf(message));
@@ -534,15 +453,22 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             if (message.contains("<html>")) {
                 message = "Server Error, ensure you are connected to the Internet";
             }
-            MainAbility.showMessageInfo(type,null,message, activity);
+            MainAbility.showMessage(message, ability);
         } catch (Throwable error) {
             error.printStackTrace();
         }
     }
 
-    public static void showMessage(String title, String message, Ability activity) {
+    /**
+     * showMessage
+     *
+     * @param title
+     * @param message
+     * @param ability
+     */
+    public static void showMessage(String title, String message, Ability ability) {
         try {
-            CommonDialog dialog = new CommonDialog(activity);
+            CommonDialog dialog = new CommonDialog(ability);
             dialog.setContentText(message);
             if (title != null) {
                 dialog.setTitleText(title);
@@ -564,114 +490,20 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         super.onActive();
     }
 
-    public static Text execcontentinfo;
-    public static void showMessageInfo(int type,String title, String message, Ability activity) {
-        CommonDialog mCommonDialog = new CommonDialog(activity);
-        Optional<Display>
-                display = DisplayManager.getInstance().getDefaultDisplay(activity);
-        DisplayAttributes displayAttributes = display.get().getAttributes();
-        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(activity).
-                parse(ResourceTable.Layout_exception_dialog,
-                        null, false);
-        mCommonDialog.setContentCustomComponent(layout)
-                .setAlignment(LayoutAlignment.CENTER)
-                .setSize(displayAttributes.width - 100,displayAttributes.height - 200)
-                .setAutoClosable(false)
-                .setTransparent(false)
-                .show();
-
-        Text ok = (Text)layout.findComponentById(ResourceTable.Id_ok);
-        execcontentinfo = (Text)layout.findComponentById(ResourceTable.Id_execcontentinfo);
-        if (message != null) {
-            execcontentinfo.setText(message);
-        }
-
-        new EventHandler(EventRunner.getMainEventRunner()).postTask(new Runnable() {
-            @Override
-            public void run() {
-                execcontentinfo.scrollTo(0, 0);
-            }
-        }, 20);
-
-        execcontentinfo.setTruncationMode(Text.TruncationMode.AUTO_SCROLLING);
-        ok.setClickedListener(new Component.ClickedListener() {
-            @Override
-            public void onClick(Component component) {
-                mCommonDialog.destroy();
-            }
-        });
-    }
-
-    public static void showMessage(String message, Ability activity) {
-        showMessage(null, message, activity);
-    }
-
-    public static void prompt(String message, Ability activity, TextField text, IDialog.ClickedListener listener) {
-        CommonDialog dialog = new CommonDialog(activity);
-        dialog.setContentText(message);
-        dialog.setContentCustomComponent(text);
-        dialog.setButton(0, "OK", listener);
-        dialog.setButton(1, "Cancel", new IDialog.ClickedListener() {
-            @Override
-            public void onClick(IDialog iDialog, int i) {
-
-            }
-        });
-        dialog.show();
-    }
-
-    public void contentRatingList() {
-        CommonDialog builder = new CommonDialog(this);
-        builder.setTitleText("Content Rating");
-
-        builder.setContentText("Select Content Rating: ");
-        builder.setButton(1, "Cancel", new IDialog.ClickedListener() {
-            @Override
-            public void onClick(IDialog iDialog, int id) {
-                // save data
-//                Preferences editor = MainAbility.current.getp.getPreferences(Context.MODE_PRIVATE)
-//                        .edit();
-//                editor.putString("contentRating", (String) spin.getSelectedItem());
-//                contentRating = (String) spin.getSelectedItem();
-//                editor.flush();
-            }
-        });
-
-        builder.setButton(1, "Cancel", new IDialog.ClickedListener() {
-            @Override
-            public void onClick(IDialog iDialog, int i) {
-
-            }
-        });
-        builder.show();
-    }
-
-    public static void confirm(String message, Ability activity, Boolean cancelable, IDialog.ClickedListener listener) {
-        CommonDialog dialog = new CommonDialog(activity);
-        dialog.setTitleText("Pizza Bot");
-        dialog.setContentText(message);
-        dialog.setButton(0, "Yes", listener);
-        dialog.setButton(1, "NO", listener);
-        if (cancelable) {
-            dialog.setButton(1, "Cancel", listener);
-        }
-        dialog.show();
+    /**
+     * showMessage
+     *
+     * @param message
+     * @param ability
+     */
+    public static void showMessage(String message, Ability ability) {
+        showMessage(null, message, ability);
     }
 
-    public static List<InstanceConfig> getAllTemplates(Ability activity) {
-        if (templates == null) {
-            try {
-//                HttpGetTemplatesAction action = new HttpGetTemplatesAction(activity);
-//                action.postExecute(action.execute().get());
-//                if (action.getException() != null) {
-//                    templates = new ArrayList<InstanceConfig>();
-//                }
-            } catch (Exception ignore) {
-            }
-        }
-        return templates;
-    }
 
+    /**
+     * REQ_PERMISSION_CODE
+     */
     public static final int REQ_PERMISSION_CODE = 1003;
     private final List<String> mPermissions =
             new LinkedList<>(
@@ -681,7 +513,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     @Override
     public void onStart(Intent intent) {
         super.onStart(intent);
-//        super.setMainRoute(MainAbilitySlice.class.getName());
         searching = false;
         browsing = false;
         searchingPosts = false;
@@ -694,7 +525,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             cookies.flushSync();
         }
 
-//        startOpenAbility(this, ChatAbility.class.getName());
 
         current = this;
         Preferences cookies = PreferencesUtils.getPreferences(this);
@@ -781,7 +611,10 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         hd = isTablet(this);
     }
 
-    public void initChat(){
+    /**
+     * showMessage
+     */
+    public void initChat() {
         chatButton = (Button) findComponentById(ResourceTable.Id_chatButton); // chat
         chatButton.setClickedListener(new Component.ClickedListener() {
             @Override
@@ -791,7 +624,10 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public void initMain(){
+    /**
+     * showMessage
+     */
+    public void initMain() {
         spin = (Button) findComponentById(ResourceTable.Id_selectButton); // 底部类型选择
         spin.setClickedListener(new Component.ClickedListener() {
             @Override
@@ -847,12 +683,14 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         helpButton.setClickedListener(new Component.ClickedListener() {
             @Override
             public void onClick(Component component) {
-                help();
             }
         });
     }
 
-    public void initBrowse(){
+    /**
+     * showMessage
+     */
+    public void initBrowse() {
         chatButton = (Button) findComponentById(ResourceTable.Id_chatButton);
         chatButton.setClickedListener(new Component.ClickedListener() {
             @Override
@@ -887,22 +725,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             }
         });
     }
-    //动态权限
-    private void reqPermissions() {
-        mPermissions.removeIf(perM -> verifySelfPermission(perM) == PERMISSION_GRANTED || !canRequestPermission(perM));
-        if (!mPermissions.isEmpty()) {
-            requestPermissionsFromUser(
-                    mPermissions.toArray(new String[0]), MainAbility.REQ_PERMISSION_CODE);
-        } else {
-            // 功能调用
-        }
-    }
 
     /**
      * 权限回调
      *
-     * @param requestCode requestCode
-     * @param ss ss
+     * @param requestCode  requestCode
+     * @param ss           ss
      * @param grantResults grantResults
      */
     @Override
@@ -921,6 +749,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
+    /**
+     * showMessage
+     */
     public void loadMemoryByBot() {
         MicroMemory.storageDir = getFilesDir();
         List<OfflineTemplateConfig> items = new ArrayList<OfflineTemplateConfig>();
@@ -934,7 +765,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         launchInstanceId = oneItem.getId();
     }
 
-    @SuppressWarnings({ "unchecked", "rawtypes" })
+    /**
+     * showMessage
+     */
     public void resetView() {
         menuButton = (Button) findComponentById(ResourceTable.Id_menuButton); // 菜单选择
         menuButton.setClickedListener(new Component.ClickedListener() {
@@ -943,42 +776,16 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
                 menu();
             }
         });
-
-
-
-        if (domain != null) {
-//            setTitle(Utils.stripTags(domain.name));
-//            HttpGetImageAction.fetchImage(this, domain.avatar, null); //-----------------
-//            HttpGetImageAction.fetchImage(this, domain.avatar, (Image) findComponentById(ResourceTable.Id_splash));
-        }
-
-        if (MainAbility.user == null) {
-            //findViewById(R.id.viewUserButton).setVisibility(View.GONE);
-            //findViewById(R.id.logoutButton).setVisibility(View.GONE);
-            //findViewById(R.id.loginButton).setVisibility(View.VISIBLE);
-        } else {
-            //findViewById(R.id.logoutButton).setVisibility(View.VISIBLE);
-            //findViewById(R.id.loginButton).setVisibility(View.GONE);
-            //findViewById(R.id.viewUserButton).setVisibility(View.VISIBLE);
-            //HttpGetImageAction.fetchImage(this, MainActivity.user.avatar, findViewById(R.id.viewUserButton));
-        }
         resetMenu(this.menu);
         resetLast();
     }
 
+    /**
+     * showMessage
+     */
     public void resetLast() {
-//        String type = MainAbility.defaultType;
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);  // 需要放入 adapter中做判断
-//        if (spin != null) {
-//            type = (String) spin.getSelectedItem();
-//            if (type.equals("Chat Bot Wars")) {
-//                spin.setSelection(0);
-//                war(null);
-//                return;
-//            }
-//        }
+
         if (type.equals("Chat Bot Wars")) {
-            war();
             return;
         }
         if (type == null) {
@@ -1014,12 +821,11 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     }
 
+    /**
+     * showMessage
+     */
     public void openLast() {
 
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);  // 适配器中做了选择赋值
-//        if (spin != null) {
-//            type = (String) spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
@@ -1064,10 +870,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
         config.name = last;
 
-//        HttpAction action = new HttpFetchAction(this, config);
-//        action.execute();
     }
 
+    /**
+     * showMessage
+     *
+     * @param menu
+     */
     public void resetMenu(Menu menu) {
         if (menu == null) {
             return;
@@ -1075,65 +884,25 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         for (int index = 0; index < menu.getItemCount(); index++) {
             menu.getItem(index).setEnabled(true);
         }
-        if (MainAbility.user == null) {
-            //menu.findItem(R.id.menuMyBots).setEnabled(false);
-            //menu.findItem(R.id.menuSignOut).setEnabled(false);
-            //menu.findItem(R.id.menuViewUser).setEnabled(false);
-            //menu.findItem(R.id.menuEditUser).setEnabled(false);
-        } else {
-            //menu.findItem(R.id.menuSignIn).setEnabled(false);
-            //menu.findItem(R.id.menuSignUp).setEnabled(false);
-        }
-
-		/*if (MicroMemory.checkExists()) {
-			menu.findItem(R.id.menuDeleteExistingBot).setEnabled(true);
-		} else {
-			menu.findItem(R.id.menuDeleteExistingBot).setEnabled(false);
-		}*/
 
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String) spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
-        // MenuItem item = menu.findItem(R.id.menuMyBots);
-        // if (type.equals("Bots")) {
-        // item.setTitle("My Bots");
-        // } else if (type.equals("Forums")) {
-        // item.setTitle("My Forums");
-        // } else if (type.equals("Live Chat")) {
-        // item.setTitle("My Channels");
-        // } else if (type.equals("Domains")) {
-        // item.setTitle("My Domains");
-        // } else if (type.equals("Avatars")) {
-        // item.setTitle("My Avatars");
-        // } else if (type.equals("Scripts")){
-        // item.setTitle("My Scripts");
-        // }else if (type.equals("Graphics")){
-        // item.setTitle("My Graphics");
-        // }
-    }
 
-    public void war() {
-//        startOpenAbility(this,StartWarAbility.class.getName()); //=====================
     }
 
+    /**
+     * login
+     */
     public void login() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-
         startOpenAbility(this, LoginAbility.class.getName());
     }
 
+    /**
+     * login
+     */
     public void logout() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
+
         connection.disconnect();
         user = null;
         instance = null;
@@ -1169,13 +938,15 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         editor.delete("deviceVoice");
         editor.flushSync();
 
-        HttpGetImageAction.clearFileCache(this);
 
         Intent intent = getIntent();
         terminateAbility();
         startAbility(intent);
     }
 
+    /**
+     * menu
+     */
     public void menu() {
         Optional<Display>
                 display = DisplayManager.getInstance().getDefaultDisplay(this);
@@ -1185,11 +956,11 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         DirectionalLayout menuComponent = (DirectionalLayout) LayoutScatter.getInstance(this)
                 .parse(ResourceTable.Layout_menu_main, null, false);
         menuDialog.setCustomComponent(menuComponent);
-        menuDialog.showOnCertainPosition(1,displayAttributes.width,-displayAttributes.width + 230);
+        menuDialog.showOnCertainPosition(1, displayAttributes.width, -displayAttributes.width + 230);
         menuDialog.setAutoClosable(true);
         Text statistics = (Text) menuComponent.findComponentById(ResourceTable.Id_title);
         Text changelanguage = (Text) menuComponent.findComponentById(ResourceTable.Id_changelanguage);
-        menuDialog.setAlignment(LayoutAlignment.RIGHT|LayoutAlignment.TOP);
+        menuDialog.setAlignment(LayoutAlignment.RIGHT | LayoutAlignment.TOP);
         menuDialog.show();
 
         Text loginButton = (Text) menuComponent.findComponentById(ResourceTable.Id_loginButton);
@@ -1224,7 +995,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         editprofile.setClickedListener(new Component.ClickedListener() {
             @Override
             public void onClick(Component component) {
-                editUser();
             }
         });
         statistics.setClickedListener(new Component.ClickedListener() {
@@ -1239,65 +1009,44 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         changelanguage.setClickedListener(new Component.ClickedListener() {
             @Override
             public void onClick(Component component) {
-                changeLanguage(MainAbility.this,null);
+                changeLanguage(MainAbility.this, null);
                 menuDialog.hide();
                 menuDialog.remove();
             }
         });
     }
 
+    /**
+     * login
+     */
     public void createUser() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//
-//        Intent intent = new Intent(this, CreateUserActivity.class);
-//        startActivity(intent);
         startOpenAbility(this, CreateUserAbility.class.getName()); //================
     }
 
-    public void editUser() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//
-//        Intent intent = new Intent(this, EditUserActivity.class);
-//        startActivity(intent);
-//        startOpenAbility(this, EditUserAbility.class.getName()); //================
-    }
-
-    public static void setOnline(boolean result){
-        if(result){
+    /**
+     * setOnline
+     *
+     * @param result
+     */
+    public static void setOnline(boolean result) {
+        if (result) {
             connection = remoteConnection;
-        }else{
+        } else {
             connection = localConnection;
         }
         online = result;
     }
 
-    public void help() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//        super.help(view);
-//        startOpenAbility(this, HelpAbility.class.getName()); //================
-    }
-
+    /**
+     * setOnline
+     */
     public void viewUser() {
         viewUser = user;
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-
-//        Intent intent = new Intent(this, ViewUserActivity.class);
-//        startActivity(intent);
-//        startOpenAbility(this, ViewUserAbility.class.getName()); //================
     }
 
+    /**
+     * setOnline
+     */
     public void openWebsite() {
         try {
             Intent intent2 = new Intent();
@@ -1311,6 +1060,9 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
+    /**
+     * setOnline
+     */
     public void createInstance() {
         if (user == null) {
             CommonDialog dialog = new CommonDialog(this);
@@ -1324,119 +1076,29 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             dialog.show();
             return;
         }
-//        Spinner spin = (Spinner) findViewById(getResources().getIdentifier("typeSpin", "id", getPackageName()));
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
+
         if (type == null) {
             type = MainAbility.defaultType;
         }
         if (type.equals("Bots")) {
             MainAbility.template = "";
-//            Intent intent = new Intent(this, CreateBotActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateBotAbility.class.getName()); //================
-        } else if (type.equals("Forums")) {
-//            Intent intent = new Intent(this, CreateForumActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateForumAbility.class.getName()); //================
-        } else if (type.equals("Live Chat")) {
-//            Intent intent = new Intent(this, CreateChannelActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateChannelAbility.class.getName()); //================
-        } else if (type.equals("Domains")) {
-//            Intent intent = new Intent(this, CreateDomainActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateDomainAbility.class.getName()); //================
-        } else if (type.equals("Avatars")) {
-//            Intent intent = new Intent(this, CreateAvatarActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateAvatarAbility.class.getName()); //================
-        } else if (type.equals("Scripts")) {
-//            Intent intent = new Intent(this, CreateScriptActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateScriptAbility.class.getName()); //================
-        } else if (type.equals("Graphics")) {
-//            Intent intent = new Intent(this, CreateGraphicActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateGraphicAbility.class.getName()); //================
         }
     }
 
+    /**
+     * setOnline
+     */
     public void search() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
-        if (type.equals("Bots")) {
-//            Intent intent = new Intent(this, BotSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, BotSearchAbility.class.getName()); //================
-        } else if (type.equals("Forums")) {
-//            Intent intent = new Intent(this, ForumSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ForumSearchAbility.class.getName()); //================
-        } else if (type.equals("Live Chat")) {
-//            Intent intent = new Intent(this, ChannelSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ChannelSearchAbility.class.getName()); //================
-        } else if (type.equals("Domains")) {
-//            Intent intent = new Intent(this, DomainSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, DomainSearchAbility.class.getName()); //================
-        } else if (type.equals("Avatars")) {
-//            Intent intent = new Intent(this, AvatarSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, AvatarSearchAbility.class.getName()); //================
-        } else if (type.equals("Scripts")) {
-//            Intent intent = new Intent(this, ScriptSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ScriptSearchAbility.class.getName()); //================
-        } else if (type.equals("Graphics")) {
-//            Intent intent = new Intent(this, GraphicSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, GraphicSearchAbility.class.getName()); //================
-        }
-    }
-
-    public void browseMyBots() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-        if (type == null) {
-            type = MainAbility.defaultType;
-        }
-        BrowseConfig config = new BrowseConfig();
-        config.typeFilter = "Personal";
-        if (type.equals("Bots")) {
-            config.type = "Bot";
-        } else if (type.equals("Forums")) {
-            config.type = "Forum";
-        } else if (type.equals("Live Chat")) {
-            config.type = "Channel";
-        } else if (type.equals("Domains")) {
-            config.type = "Domain";
-        } else if (type.equals("Avatars")) {
-            config.type = "Avatar";
-        } else if (type.equals("Scripts")) {
-            config.type = "Script";
-        } else if (type.equals("Graphics")) {
-            config.type = "Graphic";
-        }
-        config.contentRating = "Mature";
-//        HttpGetInstancesAction action = new HttpGetInstancesAction(this, config);
-//        action.execute();
     }
 
+    /**
+     * setOnline
+     */
     public void browse() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
+
         if (type == null) {
             type = MainAbility.defaultType;
         }
@@ -1458,66 +1120,31 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             config.type = "Graphic";
         }
         config.contentRating = MainAbility.contentRating;
-//        HttpGetInstancesAction action = new HttpGetInstancesAction(this, config);
-//        action.execute();
     }
 
-    /**
-     * Open the details screen.
-     */
-    public void about() {
-        WebMediumConfig config = null;
-        if (launchType == LaunchType.Bot) {
-            config = new InstanceConfig();
-        } else if (launchType == LaunchType.Forum) {
-            config = new ForumConfig();
-        } else if (launchType == LaunchType.Channel) {
-            config = new ChannelConfig();
-        }
-        config.id = launchInstanceId;
-        config.name = launchInstanceName;
-
-//        HttpAction action = new HttpFetchAction(this, config, false);
-//        action.execute();
-    }
 
     /**
      * Start a chat session with the hard coded instance.
      */
-
-    /*
-     * This method will have a list of 8 empty bot, basic, AI, julie, eddie,
-     * alice, personal assistance, juile assistance. before attaching the ID and
-     * Name of the bot make sure that its selecetd thro the list.
-     */
     public void launch() {
         setOnline(false);
         WebMediumConfig config = null;
         // the launch type is bot.
         if (MainAbility.launchType == LaunchType.Bot) {
             if (!MicroMemory.checkExists()) {
-                //ListTemplateView.offlineTemplate = true;
-                //Intent intent = new Intent(MainActivity.this, ListTemplateView.class);
-                //startActivity(intent);
-
                 config = new InstanceConfig();
-                OfflineTemplateConfig templates = new OfflineTemplateConfig(ResourceTable.Media_bot,"Pizza Bot","",""+0,0);
+                OfflineTemplateConfig templates = new OfflineTemplateConfig(ResourceTable.Media_bot, "Pizza Bot", "", "" + 0, 0);
                 //saving a template number for getting the icons and pictures of the bot
                 saveAllData(MainAbility.launchInstanceName = templates.getTitle(), MainAbility.launchInstanceId = templates.getId(), MainAbility.templateID = 0);
                 config.id = MainAbility.launchInstanceId;
                 config.name = MainAbility.launchInstanceName;
                 AvatarSelection.saveSelectedAvatar(templates.getTitle()); //============================
-                MainAbility.readZipAvatars(this, templates.getTitle());
                 MainAbility.offlineSelectedImage = templates.getImageId();
-                HttpFetchActionOffline action = new HttpFetchActionOffline(this, config, true);
-//                action.execute();
+                startOpenAbility(this, ChatAbility.class.getName());
             } else {
                 config = new InstanceConfig();
-                readZipAvatars(this, this.nameOfAvatar);
                 config.name = MainAbility.launchInstanceName;
                 config.id = MainAbility.launchInstanceId;
-                HttpFetchActionOffline action = new HttpFetchActionOffline(this, config, true);
-//                action.execute();
             }
         } else if (MainAbility.launchType == LaunchType.Forum) {
             config = new ForumConfig();
@@ -1526,8 +1153,14 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
-    public void saveAllData(String instanceId, String instanceName, int id){
-//        Preferences cookies = MainAbility.current.getPreferences(Context.MODE_PRIVATE).edit();
+    /**
+     * saveAllData
+     *
+     * @param instanceId
+     * @param instanceName
+     * @param id
+     */
+    public void saveAllData(String instanceId, String instanceName, int id) {
         Preferences cookies = PreferencesUtils.getPreferences(this);
         cookies.putString("instanceID", instanceId);
         cookies.putString("instanceName", instanceName);
@@ -1536,54 +1169,17 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     /**
-     * View the user's personal instance.
+     * selectInfo
      */
-    public void browseMyBot() {
-        if (user == null) {
-            CommonDialog dialog = new CommonDialog(this);
-            dialog.setContentText("You must sign in first");
-            dialog.setButton(1, "OK", new IDialog.ClickedListener() {
-                @Override
-                public void onClick(IDialog iDialog, int i) {
-                    login();
-                }
-            });
-            dialog.show();
-            return;
-        }
-        WebMediumConfig config = new InstanceConfig();
-        config.name = "Bot " + MainAbility.user.user;
-
-//        HttpAction action = new HttpFetchOrCreateAction(this, config, false);
-//        action.execute();
-    }
+    public static String selectInfo = "";
+    Text languageselect;
 
     /**
-     * Start a chat session with the user's personal instance.
+     * reInitialize
+     *
+     * @param activty
+     * @param listener
      */
-    public void launchMyBot(View view) {
-        if (user == null) {
-            CommonDialog dialog = new CommonDialog(this);
-            dialog.setContentText("You must sign in first");
-            dialog.setButton(1, "OK", new IDialog.ClickedListener() {
-                @Override
-                public void onClick(IDialog iDialog, int i) {
-                    login();
-                }
-            });
-            dialog.show();
-            return;
-        }
-        WebMediumConfig config = new InstanceConfig();
-        config.name = "Bot " + MainAbility.user.user;
-
-//        HttpAction action = new HttpFetchOrCreateAction(this, config, true);
-//        action.execute();
-    }
-
-    public static String selectInfo = "";
-    Text languageselect;
-    @SuppressWarnings({ "rawtypes", "unchecked" })
     public void changeLanguage(Ability activty, final IDialog.ClickedListener listener) {
         Optional<Display>
                 display = DisplayManager.getInstance().getDefaultDisplay(this);
@@ -1594,9 +1190,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
         CommonDialog dialog = new CommonDialog(MainAbility.this);
         setOnline(true);
-//        dialog.setTitleText("    Languages");
-        dialog.setSize(displayAttributes.width - 100,displayAttributes.width - 300);
-//        dialog.setContentText("Select your language");
+        dialog.setSize(displayAttributes.width - 100, displayAttributes.width - 300);
         dialog.setContentCustomComponent(layout);
         dialog.show();
 
@@ -1604,7 +1198,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         Text ok = (Text) layout.findComponentById(ResourceTable.Id_ok);
         Text cancel = (Text) layout.findComponentById(ResourceTable.Id_cancel);
 
-        SpinnerAdapter spinnerAdapter = new SpinnerAdapter(this,MainAbility.languages);
+        SpinnerAdapter spinnerAdapter = new SpinnerAdapter(this, MainAbility.languages);
         languageselect.setClickedListener(new Component.ClickedListener() {//弹出选择语言对话框
             @Override
             public void onClick(Component component) {
@@ -1617,21 +1211,17 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         if (MainAbility.voice != null && MainAbility.voice.language != null) {
             index = Arrays.asList(MainAbility.languages).indexOf(MainAbility.voice.language);
         }
-//        spin.setSelection(index);
-
-        if (MainAbility.voice != null && MainAbility.voice.language != null){
+        if (MainAbility.voice != null && MainAbility.voice.language != null) {
             for (int i = 0; i < spinnerAdapter.getCount(); i++) {
-                if(MainAbility.languages[i].contains(MainAbility.voice.language + " - ")){
+                if (MainAbility.languages[i].contains(MainAbility.voice.language + " - ")) {
 //                    spin.setSelection(i);
                     selectInfo = MainAbility.languages[i];
                 }
             }
         }
-//        dialog.setView(spin);
         ok.setClickedListener(new Component.ClickedListener() {
             @Override
             public void onClick(Component component) {
-                // String lang = (String)spin.getSelectedItem();
                 String lang = MainAbility.selectInfo;
                 if (lang.equals("Default")) {
                     MainAbility.translate = false;
@@ -1661,9 +1251,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
                     cookies.putString("nativeVoice", String.valueOf(MainAbility.voice.nativeVoice));
                     cookies.flushSync();
                 }
-//                if (listener != null) {
-//                    listener.onClick(dialog, i);
-//                }
                 dialog.hide();
                 dialog.remove();
             }
@@ -1675,21 +1262,4 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             }
         });
     }
-
-    public static void readZipAvatars(Ability activity, String fileName) {
-        // this is only for letting Julie Assistance Avatar works, since there
-        // is only one file called
-        // "Julie" I will have to take this name and read the file from the
-        // method @readZipAvatars.
-        String args[] = fileName.split("\\s+");
-        // ex: Julie = Julie
-        // Julie Assistant = Julie
-        // Its only going to take one name
-        try {
-//            GetAvatarAction avatar = new GetAvatarAction(activity);
-//            avatar.readZipFile(args[0] + ".zip");
-//            MicroConnection.avatarConfig = avatar.instance;
-        } catch (Exception ignore) {
-        }
-    }
 }
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/PaphusCredentials.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/PaphusCredentials.java
deleted file mode 100644
index 80c9fa62353e0d93506cd00057426d6df67d96ab..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/PaphusCredentials.java
+++ /dev/null
@@ -1,36 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk;
-
-/**
- * Credentials for use with hosted services on the Bot Libre for Business website,
- * a commercial bot, live chat, chatroom, and forum hosting service.
- * https://www.botlibre.biz
- */
-public class PaphusCredentials extends Credentials {
-	public static String DOMAIN = "www.botlibre.biz";
-	//public static String DOMAIN = "192.168.0.11:9080";
-	public static String APP = "";
-	//public static String APP = "/livechat";
-	public static String PATH = "/rest/api";
-
-	public PaphusCredentials(String applicationId) {
-		this.host = DOMAIN;
-		this.app = APP;
-		this.url = "https://" + DOMAIN + APP + PATH;
-		this.applicationId = applicationId;
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/SDKConnection.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
index 61386c622727af293cffe9564d65ada460e07d67..c27e8ba7f56f0d8dd7360095bcc201244c02d163 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
@@ -15,51 +15,12 @@
 
 package org.botlibre.sdk;
 
-import java.io.ByteArrayOutputStream;
-import java.io.File;
-import java.io.FileInputStream;
-import java.io.IOException;
-import java.io.StringReader;
-import java.net.URL;
-import java.util.ArrayList;
-import java.util.List;
-
 import com.franmontiel.persistentcookiejar.ClearableCookieJar;
 import com.franmontiel.persistentcookiejar.PersistentCookieJar;
 import com.franmontiel.persistentcookiejar.cache.SetCookieCache;
 import com.franmontiel.persistentcookiejar.persistence.SharedPrefsCookiePersistor;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.AvatarMedia;
-import org.botlibre.sdk.config.AvatarMessage;
-import org.botlibre.sdk.config.BotModeConfig;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ChannelConfig;
-import org.botlibre.sdk.config.ChatConfig;
-import org.botlibre.sdk.config.ChatResponse;
-import org.botlibre.sdk.config.Config;
-import org.botlibre.sdk.config.ContentConfig;
-import org.botlibre.sdk.config.ConversationConfig;
-import org.botlibre.sdk.config.DomainConfig;
-import org.botlibre.sdk.config.ForumConfig;
-import org.botlibre.sdk.config.ForumPostConfig;
-import org.botlibre.sdk.config.GraphicConfig;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.IssueConfig;
-import org.botlibre.sdk.config.LearningConfig;
-import org.botlibre.sdk.config.MediaConfig;
-import org.botlibre.sdk.config.ResponseConfig;
-import org.botlibre.sdk.config.ResponseSearchConfig;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import org.botlibre.sdk.config.Speech;
-import org.botlibre.sdk.config.TrainingConfig;
-import org.botlibre.sdk.config.UserAdminConfig;
-import org.botlibre.sdk.config.UserConfig;
-import org.botlibre.sdk.config.UserMessageConfig;
-import org.botlibre.sdk.config.VoiceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
 import ohos.aafwk.ability.Ability;
-import ohos.media.image.PixelMap;
+import ohos.agp.components.element.ShapeElement;
 import okhttp3.Call;
 import okhttp3.MediaType;
 import okhttp3.OkHttpClient;
@@ -69,1936 +30,537 @@ import okhttp3.Response;
 import org.apache.http.HttpEntity;
 import org.apache.http.HttpResponse;
 import org.apache.http.client.HttpClient;
-import org.apache.http.client.methods.HttpGet;
 import org.apache.http.client.methods.HttpPost;
 import org.apache.http.entity.StringEntity;
-import org.apache.http.entity.mime.HttpMultipartMode;
-import org.apache.http.entity.mime.MultipartEntity;
-import org.apache.http.entity.mime.content.ByteArrayBody;
-import org.apache.http.entity.mime.content.StringBody;
 import org.apache.http.impl.client.DefaultHttpClient;
 import org.apache.http.protocol.BasicHttpContext;
 import org.apache.http.protocol.HTTP;
 import org.apache.http.protocol.HttpContext;
 import org.apache.http.util.EntityUtils;
+import org.botlibre.sdk.config.AvatarConfig;
+import org.botlibre.sdk.config.AvatarMedia;
+import org.botlibre.sdk.config.DomainConfig;
+import org.botlibre.sdk.config.ForumPostConfig;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.IssueConfig;
+import org.botlibre.sdk.config.ResponseConfig;
+import org.botlibre.sdk.config.UserConfig;
+import org.botlibre.sdk.config.WebMediumConfig;
 import org.w3c.dom.Document;
 import org.w3c.dom.Element;
-import org.xml.sax.InputSource;
 
-import javax.xml.parsers.DocumentBuilder;
-import javax.xml.parsers.DocumentBuilderFactory;
+import java.io.IOException;
+import java.util.ArrayList;
+import java.util.List;
 
 /**
- * Connection class for a REST service connection.
- * The SDK connection gives you access to the paphus or libre server services using a REST API.
- * <p>
- * The services include:
- * <ul>
- * <li> User management (account creation, validation)
- * <li> Bot access, chat, and administration
- * <li> Forum access, posting, and administration
- * <li> Live chat access, chat, and administration
- * <li> Domain access, and administration
- * </ul>
+ * SDKConnection
+ *
+ * @since 2021-04-16
  */
 public class SDKConnection {
-	protected static String[] types = new String[]{"Bots", "Forums", "Graphics", "Live Chat", "Domains", "Scripts", "IssueTracker"};
-	protected static String[] channelTypes = new String[]{"ChatRoom", "OneOnOne"};
-	protected static String[] accessModes = new String[]{"Everyone", "Users", "Members", "Administrators"};
-	protected static String[] mediaAccessModes = new String[]{"Everyone", "Users", "Members", "Administrators", "Disabled"};
-	protected static String[] learningModes = new String[]{"Disabled", "Administrators", "Users", "Everyone"};
-	protected static String[] correctionModes = new String[]{"Disabled", "Administrators", "Users", "Everyone"};
-	protected static String[] botModes = new String[]{"ListenOnly", "AnswerOnly", "AnswerAndListen"};
-	protected static String[] priorities = new String[]{"Low", "Medium", "High", "Sever"};
-	
-	protected String url;
-	protected UserConfig user;
-	protected DomainConfig domain;
-	protected Credentials credentials;
-	protected boolean debug = false;
-	
-	protected SDKException exception;
-
-	/**
-	 * Return the name of the default user image.
-	 */
-	public static String defaultUserImage() {
-		return "images/user-thumb.jpg";
-	}
-	
-	/**
-	 * Create an SDK connection.
-	 */
-	public SDKConnection() {
-	}
-	
-	/**
-	 * Create an SDK connection with the credentials.
-	 * Use the Credentials subclass specific to your server.
-	 */
-	public SDKConnection(Credentials credentials) {
-		this.credentials = credentials;
-		this.url = credentials.url;
-	}
-	
-	/**
-	 * Validate the user credentials (password, or token).
-	 * The user details are returned (with a connection token, password removed).
-	 * The user credentials are soted in the connection, and used on subsequent calls.
-	 * An SDKException is thrown if the connect failed.
-	 */
-	public UserConfig connect(UserConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/check-user", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			this.user = null;
-			return null;
-		}
-		try {
-			UserConfig user = new UserConfig();
-			user.parseXML(root);
-			this.user = user;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-		return this.user;
-	}
-	
-	/**
-	 * Execute the custom API.
-	 */
-	public Config custom(String api, Config config, Config result) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/" + api, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			result.parseXML(root);
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-		return result;
-	}
-	
-	/**
-	 * Connect to the live chat channel and return a LiveChatConnection.
-	 * A LiveChatConnection is separate from an SDKConnection and uses web sockets for
-	 * asynchronous communication.
-	 * The listener will be notified of all messages.
-	 */
-	public LiveChatConnection openLiveChat(ChannelConfig channel, LiveChatListener listener) {
-		LiveChatConnection connection = new LiveChatConnection(this.credentials, listener);
-		connection.connect(channel, this.user);
-		return connection;
-	}
-	
-	/**
-	 * Connect to the domain.
-	 * A domain is an isolated content space.
-	 * Any browse or query request will be specific to the domain's content.
-	 */	
-	public DomainConfig connect(DomainConfig config) {
-		this.domain = fetch(config);
-		return this.domain;
-	}
-	
-	/**
-	 * Disconnect from the connection.
-	 * An SDKConnection does not keep a live connection, but this resets its connected user and domain.
-	 */	
-	public void disconnect() {
-		this.user = null;
-		this.domain = null;
-	}
-	
-	/**
-	 * Fetch the user details.
-	 */	
-	public UserConfig fetch(UserConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/view-user", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			UserConfig user = new UserConfig();
-			user.parseXML(root);
-			return user;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Fetch the URL for the image from the server.
-	 */	
-	public URL fetchImage(String image) {
-		try {
-			return new URL("http://" + this.credentials.host + this.credentials.app + "/" + image);
-		} catch (Exception exception) {
-			this.exception = new SDKException(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Fetch the forum post details for the forum post id.
-	 */	
-	public ForumPostConfig fetch(ForumPostConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/check-forum-post", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ForumPostConfig post = new ForumPostConfig();
-			post.parseXML(root);
-			return post;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Fetch the issue details for the issue id.
-	 */
-	public IssueConfig fetch(IssueConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/check-issue", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			IssueConfig issue = new IssueConfig();
-			issue.parseXML(root);
-			return issue;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create a new user.
-	 */
-	public UserConfig create(Ability ability,UserConfig config) {
-		config.addCredentials(this);
-		String xml = POSTUpdate(ability,this.url + "/create-user", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			UserConfig user = new UserConfig();
-			user.parseXML(root);
-			this.user = user;
-			return user;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create a new forum post.
-	 * You must set the forum id for the post.
-	 */
-	public ForumPostConfig create(ForumPostConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/create-forum-post", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ForumPostConfig post = new ForumPostConfig();
-			post.parseXML(root);
-			return post;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new issue.
-	 * You must set the issue tracker id for the issue.
-	 */
-	public IssueConfig create(IssueConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/create-issue", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			IssueConfig issue = new IssueConfig();
-			issue.parseXML(root);
-			return issue;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new file/image/media attachment for a chat channel.
-	 */
-	public MediaConfig createChannelFileAttachment(String file, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTFILE(this.url + "/create-channel-attachment", file, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new image attachment for a chat channel.
-	 */
-	public MediaConfig createChannelImageAttachment(String file, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/create-channel-attachment", file, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new file/image/media attachment for an issue tracker.
-	 */
-	public MediaConfig createIssueTrackerFileAttachment(String file, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTFILE(this.url + "/create-issuetracker-attachment", file, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new image attachment for an issue tracker.
-	 */
-	public MediaConfig createIssueTrackerImageAttachment(String file, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/create-issuetracker-attachment", file, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Create a new image attachment for an issue tracker.
-	 */
-	public MediaConfig createIssueTrackerImageAttachment(PixelMap bitmap, MediaConfig config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/create-issuetracker-attachment", bitmap, config.name, config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			MediaConfig media = new MediaConfig();
-			media.parseXML(root);
-			return media;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create a reply to a forum post.
-	 * You must set the parent id for the post replying to.
-	 */
-	public ForumPostConfig createReply(ForumPostConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/create-reply", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ForumPostConfig reply = new ForumPostConfig();
-			reply.parseXML(root);
-			return reply;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create a user message.
-	 * This can be used to send a user a direct message.
-	 * SPAM will cause your account to be deleted.
-	 */
-	public void createUserMessage(UserMessageConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/create-user-message", config.toXML());
-	}
-	
-	/**
-	 * Fetch the content details from the server.
-	 * The id or name and domain of the object must be set.
-	 */
-	@SuppressWarnings("unchecked")
-	public <T extends WebMediumConfig> T fetch(T config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/check-" + config.getType(), config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = (T)config.getClass().newInstance();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create the new content.
-	 * The content will be returned with its new id.
-	 */
-	@SuppressWarnings("unchecked")
-	public <T extends WebMediumConfig> T create(T config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/create-" + config.getType(), config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = (T)config.getClass().newInstance();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Update the content.
-	 */
-	@SuppressWarnings("unchecked")
-	public <T extends WebMediumConfig> T update(T config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/update-" + config.getType(), config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = (T)config.getClass().newInstance();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Update the forum post.
-	 */
-	public ForumPostConfig update(ForumPostConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/update-forum-post", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = new ForumPostConfig();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-
-	/**
-	 * Update the issue.
-	 */
-	public IssueConfig update(IssueConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/update-issue", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = new IssueConfig();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create or update the response.
-	 * This can also be used to flag, unflag, validate, or invalidate a response.
-	 */
-	public ResponseConfig saveResponse(ResponseConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/save-response", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ResponseConfig response = new ResponseConfig();
-			response.parseXML(root);
-			return response;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Update the user details.
-	 * The password must be passed to allow the update.
-	 */
-	public UserConfig update(UserConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/update-user", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			UserConfig user = new UserConfig();
-			user.parseXML(root);
-			this.user = user;
-			return user;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Permanently delete the content with the id.
-	 */
-	public void delete(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-" + config.getType(), config.toXML());
-		if(this.domain!=null && this.domain.id.equals(config.id) && config.getType().equals("domain") ){
-			domain=null;
-		}
-	}
-	
-	/**
-	 * Permanently delete the forum post with the id.
-	 */
-	public void delete(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-forum-post", config.toXML());
-	}
-
-	/**
-	 * Permanently delete the issue with the id.
-	 */
-	public void delete(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-issue", config.toXML());
-	}
-	
-	/**
-	 * Permanently delete the response, greetings, or default response with the response id (and question id).
-	 */
-	public void delete(ResponseConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-response", config.toXML());
-	}
-	
-	/**
-	 * Permanently delete the avatar media.
-	 */
-	public void delete(AvatarMedia config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-avatar-media", config.toXML());
-	}
-	
-	/**
-	 * Permanently delete the avatar background.
-	 */
-	public void deleteAvatarBackground(AvatarConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-avatar-background", config.toXML());
-	}
-	
-	/**
-	 * Save the avatar media tags.
-	 */
-	public void saveAvatarMedia(AvatarMedia config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-avatar-media", config.toXML());
-	}
-	
-	/**
-	 * Flag the content as offensive, a reason is required.
-	 */
-	public void flag(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/flag-" + config.getType(), config.toXML());
-	}
-	
-	/**
-	 * Subscribe for email updates for the post.
-	 */
-	public void subscribe(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/subscribe-post", config.toXML());
-	}
-
-	/**
-	 * Subscribe for email updates for the issue.
-	 */
-	public void subscribe(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/subscribe-issue", config.toXML());
-	}
-	
-	/**
-	 * Subscribe for email updates for the forum.
-	 */
-	public void subscribe(ForumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/subscribe-forum", config.toXML());
-	}
-	
-	/**
-	 * Unsubscribe from email updates for the post.
-	 */
-	public void unsubscribe(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/unsubscribe-post", config.toXML());
-	}
-
-	/**
-	 * Unsubscribe from email updates for the issue.
-	 */
-	public void unsubscribe(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/unsubscribe-issue", config.toXML());
-	}
-	
-	/**
-	 * Unsubscribe from email updates for the forum.
-	 */
-	public void unsubscribe(ForumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/unsubscribe-forum", config.toXML());
-	}
-	
-	/**
-	 * Thumbs up the content.
-	 */
-	public void thumbsUp(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-up-" + config.getType(), config.toXML());
-	}
-	
-	/**
-	 * Thumbs down the content.
-	 */
-	public void thumbsDown(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-down-" + config.getType(), config.toXML());
-	}
-	
-	/**
-	 * Rate the content.
-	 */
-	public void star(WebMediumConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/star-" + config.getType(), config.toXML());
-	}
-	
-	/**
-	 * Thumbs up the content.
-	 */
-	public void thumbsUp(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-up-post", config.toXML());
-	}
-	
-	/**
-	 * Thumbs down the content.
-	 */
-	public void thumbsDown(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-down-post", config.toXML());
-	}
-	
-	/**
-	 * Rate the content.
-	 */
-	public void star(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/star-post", config.toXML());
-	}
-	
-	/**
-	 * Flag the forum post as offensive, a reason is required.
-	 */
-	public void flag(ForumPostConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/flag-forum-post", config.toXML());
-	}
-
-	/**
-	 * Thumbs up the content.
-	 */
-	public void thumbsUp(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-up-issue", config.toXML());
-	}
-
-	/**
-	 * Thumbs down the content.
-	 */
-	public void thumbsDown(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/thumbs-down-issue", config.toXML());
-	}
-
-	/**
-	 * Rate the content.
-	 */
-	public void star(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/star-issue", config.toXML());
-	}
-
-	/**
-	 * Flag the forum post as offensive, a reason is required.
-	 */
-	public void flag(IssueConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/flag-issue", config.toXML());
-	}
-	
-	/**
-	 * Flag the user post as offensive, a reason is required.
-	 */
-	public void flag(UserConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/flag-user", config.toXML());
-	}
-	
-	/**
-	 * Process the bot chat message and return the bot's response.
-	 * The ChatConfig should contain the conversation id if part of a conversation.
-	 * If a new conversation the conversation id is returned in the response. 
-	 */
-	public ChatResponse chat(ChatConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/post-chat", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ChatResponse response = new ChatResponse();
-			response.parseXML(root);
-			return response;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Process the avatar message and return the avatars response.
-	 * This allows the speech and video animation for an avatar to be generated for the message.
-	 */
-	public ChatResponse avatarMessage(AvatarMessage config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/avatar-message", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ChatResponse response = new ChatResponse();
-			response.parseXML(root);
-			return response;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Process the speech message and return the server generate text-to-speech audio file.
-	 * This allows for server-side speech generation.
-	 */
-	public String tts(Speech config) {
-		config.addCredentials(this);
-		return POST(this.url + "/speak", config.toXML());
-	}
-	
-	/**
-	 * Return the administrators of the content.
-	 */
-	public List<String> getAdmins(WebMediumConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-" + config.getType() + "-admins", config.toXML());
-		List<String> users = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return users;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			UserConfig user = new UserConfig();
-			user.parseXML((Element)root.getChildNodes().item(index));
-			users.add(user.user);
-		}
-		return users;
-	}
-	
-	/**
-	 * Return the list of user details for the comma separated values list of user ids.
-	 */
-	public List<UserConfig> getUsers(String usersCSV) {
-		UserConfig config = new UserConfig();
-		config.user = usersCSV;
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-users", config.toXML());
-		List<UserConfig> users = new ArrayList<UserConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return users;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			Element child = (Element)root.getChildNodes().item(index);
-			UserConfig userConfig = new UserConfig();
-			userConfig.parseXML(child);
-			users.add(userConfig);
-		}
-		return users;
-	}
-	
-	/**
-	 * Return the list of forum posts for the forum browse criteria.
-	 */
-	public List<ForumPostConfig> getPosts(BrowseConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-forum-posts", config.toXML());
-		List<ForumPostConfig> instances = new ArrayList<ForumPostConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return instances;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			ForumPostConfig post = new ForumPostConfig();
-			post.parseXML((Element)root.getChildNodes().item(index));
-			instances.add(post);
-		}
-		return instances;
-	}
-
-	/**
-	 * Return the list of issues for the issue tracker browse criteria.
-	 */
-	public List<IssueConfig> getIssues(BrowseConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-issues", config.toXML());
-		List<IssueConfig> instances = new ArrayList<IssueConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return instances;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			IssueConfig issue = new IssueConfig();
-			issue.parseXML((Element)root.getChildNodes().item(index));
-			instances.add(issue);
-		}
-		return instances;
-	}
-	
-	/**
-	 * Return the list of categories for the type, and domain.
-	 */
-	public List<ContentConfig> getCategories(ContentConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-categories", config.toXML());
-		List<ContentConfig> categories = new ArrayList<ContentConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return categories;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			ContentConfig category = new ContentConfig();
-			category.parseXML((Element)root.getChildNodes().item(index));
-			categories.add(category);
-		}
-		return categories;
-	}
-	
-	/**
-	 * Return the list of tags for the type, and domain.
-	 */
-	public List<String> getTags(ContentConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-tags", config.toXML());
-		List<String> tags = new ArrayList<String>();
-		tags.add("");
-		Element root = parse(xml);
-		if (root == null) {
-			return tags;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			tags.add(((Element)root.getChildNodes().item(index)).getAttribute("name"));
-		}
-		return tags;
-	}
-	
-	/**
-	  * Return the list of bot templates.
-	  */
-	
-	//return the list of templates with the pictures.
-	 public List<InstanceConfig> getTemplates() {
-	  String xml = GET(this.url + "/get-all-templates");
-	  List<InstanceConfig> instances = new ArrayList<InstanceConfig>();
-	  Element root = parse(xml);
-	  if (root == null) {
-	   return instances;
-	  }
-	  for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-	   InstanceConfig instance = new InstanceConfig();
-	   instance.parseXML((Element)root.getChildNodes().item(index));
-	   instances.add(instance);
-	  }
-	  return instances;
-	 }
-	
-	/**
-	 * Return the users for the content.
-	 */
-	public List<String> getUsers(WebMediumConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-" + config.getType() + "-users", config.toXML());
-		List<String> users = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return users;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			UserConfig user = new UserConfig();
-			user.parseXML((Element)root.getChildNodes().item(index));
-			users.add(user.user);
-		}
-		return users;
-	}
-	
-	/**
-	 * Return the channel's bot configuration.
-	 */
-	public BotModeConfig getChannelBotMode(ChannelConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-channel-bot-mode", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			BotModeConfig botMode = new BotModeConfig();
-			botMode.parseXML(root);
-			return botMode;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Save the channel's bot configuration.
-	 */
-	public void saveChannelBotMode(BotModeConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-channel-bot-mode", config.toXML());
-	}
-	
-	/**
-	 * Save the forum's bot configuration.
-	 */
-	public void saveForumBotMode(BotModeConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-forum-bot-mode", config.toXML());
-	}
-	
-	/**
-	 * Save the bot's learning configuration.
-	 */
-	public void saveLearning(LearningConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-learning", config.toXML());
-	}
-	
-	/**
-	 * Save the bot's voice configuration.
-	 */
-	public void saveVoice(VoiceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-voice", config.toXML());
-	}
-	
-	/**
-	 * Save the bot's avatar configuration.
-	 */
-	public void saveBotAvatar(InstanceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-bot-avatar", config.toXML());
-	}
-	
-	/**
-	 * Train the bot with a new question/response pair.
-	 */
-	public void train(TrainingConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/train-instance", config.toXML());
-	}
-	
-	/**
-	 * Perform the user administration task (add or remove users, or administrators).
-	 */
-	public void userAdmin(UserAdminConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/user-admin", config.toXML());
-	}
-	
-	/**
-	 * Save the image as the avatar's background.
-	 */
-	public void saveAvatarBackground(String file, AvatarMedia config) {
-		config.addCredentials(this);
-		POSTIMAGE(this.url + "/save-avatar-background", file, config.name, config.toXML());
-	}
-	
-	/**
-	 * Add the avatar media file to the avatar.
-	 */
-	public void createAvatarMedia(String file, AvatarMedia config) {
-		config.addCredentials(this);
-		if ((file.indexOf(".jpg") != -1) || (file.indexOf(".jpeg") != -1)) {
-			if (config.hd) {
-				POSTHDIMAGE(this.url + "/create-avatar-media", file, config.name, config.toXML());
-			} else {
-				POSTIMAGE(this.url + "/create-avatar-media", file, config.name, config.toXML());
-			}
-		} else {
-			POSTFILE(this.url + "/create-avatar-media", file, config.name, config.toXML());
-		}
-	}
-	/**
-	 * Add the graphic media file to the graphic.
-	 */
-	public void createGraphicMedia(String file, GraphicConfig config) {
-		config.addCredentials(this);
-		if ((file.indexOf(".jpg") != -1) || (file.indexOf(".jpeg") != -1)) {
-			POSTIMAGE(this.url + "/update-graphic-media", file, config.fileName, config.toXML());
-		} else {
-			POSTFILE(this.url + "/update-graphic-media", file, config.fileName, config.toXML());
-		}
-	}
-	/**
-	 * Update the contents icon.
-	 * The file will be uploaded to the server.
-	 */
-	@SuppressWarnings("unchecked")
-	public <T extends WebMediumConfig> T updateIcon(String file, T config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/update-" + config.getType() + "-icon", file, "image.jpg", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = (T)config.getClass().newInstance();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Update the user's icon.
-	 * The file will be uploaded to the server.
-	 */
-	public UserConfig updateIcon(String file, UserConfig config) {
-		config.addCredentials(this);
-		String xml = POSTIMAGE(this.url + "/update-user-icon", file, "image.jpg", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			config = new UserConfig();
-			config.parseXML(root);
-			return config;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	public String POSTIMAGE(String url, String file, String name, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("file: " + file);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-//		try { //=====================
-//			Bitmap bitmap = loadImage(file, 600, 600);
-//	        ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//	        bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream);
-//	        byte[] byte_arr = stream.toByteArray();
-//	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-//
-//	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-//
-//	        multipartEntity.addPart("file", fileBody);
-//	        multipartEntity.addPart("xml", new StringBody(xml));
-//
-//	        HttpClient httpclient = new DefaultHttpClient();
-//	        HttpResponse response = null;
-//
-//            HttpPost httppost = new HttpPost(url);
-//            httppost.setEntity(multipartEntity);
-//            response = httpclient.execute(httppost);
-//
-//			HttpEntity entity = response.getEntity();
-//			if (entity != null) {
-//				result = EntityUtils.toString(entity, HTTP.UTF_8);
-//			}
-//
-//			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-//				this.exception = new SDKException(""
-//				   + response.getStatusLine().getStatusCode()
-//				   + " : " + result);
-//	 			throw this.exception;
-//			}
-//
-//        } catch (Exception exception) {
-// 			this.exception = new SDKException(exception);
-// 			throw this.exception;
-// 		}
- 		return result;
-	}
-
-	public String POSTIMAGE(String url, PixelMap bitmap, String name, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		try {
-			ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//			bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream); //=====================
-			byte[] byte_arr = stream.toByteArray();
-			ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-
-			MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-
-			multipartEntity.addPart("file", fileBody);
-			multipartEntity.addPart("xml", new StringBody(xml));
-
-			HttpClient httpclient = new DefaultHttpClient();
-			HttpResponse response = null;
-
-			HttpPost httppost = new HttpPost(url);
-			httppost.setEntity(multipartEntity);
-			response = httpclient.execute(httppost);
-
-			HttpEntity entity = response.getEntity();
-			if (entity != null) {
-				result = EntityUtils.toString(entity, HTTP.UTF_8);
-			}
-
-			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-				this.exception = new SDKException(""
-						+ response.getStatusLine().getStatusCode()
-						+ " : " + result);
-				throw this.exception;
-			}
-
-		} catch (Exception exception) {
-			this.exception = new SDKException(exception);
-			throw this.exception;
-		}
-		return result;
-	}
-	
-	public String POSTHDIMAGE(String url, String file, String name, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("file: " + file);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		try {
-//			Bitmap bitmap = loadImage(file, 600, 600);  //=====================
-//	        ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//	        bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream);
-//	        byte[] byte_arr = stream.toByteArray();
-//	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-//
-//	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-//
-//	        multipartEntity.addPart("file", fileBody);
-//	        multipartEntity.addPart("xml", new StringBody(xml));
-//
-//	        HttpClient httpclient = new DefaultHttpClient();
-//	        HttpResponse response = null;
-//
-//            HttpPost httppost = new HttpPost(url);
-//            httppost.setEntity(multipartEntity);
-//            response = httpclient.execute(httppost);
-//
-//			HttpEntity entity = response.getEntity();
-//			if (entity != null) {
-//				result = EntityUtils.toString(entity, HTTP.UTF_8);
-//			}
-//
-//			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-//				this.exception = new SDKException(""
-//				   + response.getStatusLine().getStatusCode()
-//				   + " : " + result);
-//	 			throw this.exception;
-//			}
-
+    protected static String[] accessModes = new String[]{"Everyone", "Users", "Members", "Administrators"};
+    protected static String[] mediaAccessModes = new String[]{"Everyone", "Users", "Members", "Administrators", "Disabled"};
+
+    protected String url;
+    protected UserConfig user;
+    protected DomainConfig domain;
+    protected Credentials credentials;
+    protected boolean debug = false;
+
+    protected SDKException exception;
+
+
+    /**
+     * Create an SDK connection.
+     */
+    public SDKConnection() {
+    }
+
+    /**
+     * Create an SDK connection with the credentials.
+     * Use the Credentials subclass specific to your server.
+     *
+     * @param credentials
+     */
+    public SDKConnection(Credentials credentials) {
+        this.credentials = credentials;
+        this.url = credentials.url;
+    }
+
+    /**
+     * Validate the user credentials (password, or token).
+     * The user details are returned (with a connection token, password removed).
+     * The user credentials are soted in the connection, and used on subsequent calls.
+     * An SDKException is thrown if the connect failed.
+     *
+     * @param config
+     * @return user
+     */
+    public UserConfig connect(UserConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/check-user", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            this.user = null;
+            return null;
+        }
+        try {
+            UserConfig user = new UserConfig();
+            user.parseXML(root);
+            this.user = user;
         } catch (Exception exception) {
- 			this.exception = new SDKException(exception);
- 			throw this.exception;
- 		}
- 		return result;
-	}
-	
-	public String POSTFILE(String url, String path, String name, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("file: " + path);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		try {
-			File file = new File(path);
-			FileInputStream stream = new FileInputStream(file);
-			ByteArrayOutputStream output = new ByteArrayOutputStream();
-			int read = 0;
-	        byte[] buffer = new byte[4096];
-	        while ((read = stream.read(buffer)) != -1 ) {
-	        	output.write(buffer, 0, read);
-	        }
-	        byte[] byte_arr = output.toByteArray();
-	        stream.close();
-	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-	
-	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-	
-	        multipartEntity.addPart("file", fileBody);
-	        multipartEntity.addPart("xml", new StringBody(xml));
-	
-	        HttpClient httpclient = new DefaultHttpClient();
-	        HttpResponse response = null;
-
-            HttpPost httppost = new HttpPost(url);
-            httppost.setEntity(multipartEntity);
-            response = httpclient.execute(httppost);
-			
-			HttpEntity entity = response.getEntity();
-			if (entity != null) {
-				result = EntityUtils.toString(entity, HTTP.UTF_8);
-			}
-
-			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-				this.exception = new SDKException(""
-				   + response.getStatusLine().getStatusCode()
-				   + " : " + result);
-	 			throw this.exception;
-			}
-
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+        return this.user;
+    }
+
+    /**
+     * Connect to the domain.
+     * A domain is an isolated content space.
+     * Any browse or query request will be specific to the domain's content.
+     *
+     * @param config
+     * @return domain
+     */
+    public DomainConfig connect(DomainConfig config) {
+        this.domain = fetch(config);
+        return this.domain;
+    }
+
+    /**
+     * Disconnect from the connection.
+     * An SDKConnection does not keep a live connection, but this resets its connected user and domain.
+     */
+    public void disconnect() {
+        this.user = null;
+        this.domain = null;
+    }
+
+    /**
+     * reInitialize
+     *
+     * @param ability
+     * @param config
+     * @return user
+     */
+    public UserConfig create(Ability ability, UserConfig config) {
+        config.addCredentials(this);
+        String xml = POSTUpdate(ability, this.url + "/create-user", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            UserConfig user = new UserConfig();
+            user.parseXML(root);
+            this.user = user;
+            return user;
         } catch (Exception exception) {
- 			this.exception = new SDKException(exception);
- 			throw this.exception;
- 		}
- 		return result;
-	}
-
-	public PixelMap loadImage(String path, int reqWidth, int reqHeight) {
-//	    BitmapFactory.Options options = new BitmapFactory.Options(); //=====================
-//	    options.inJustDecodeBounds = true;
-//	    BitmapFactory.decodeFile(path, options);
-//
-//        int height = options.outHeight;
-//        int width = options.outWidth;
-//        options.inPreferredConfig = Bitmap.Config.RGB_565;
-//        int inSampleSize = 1;
-//
-//        if (height > reqHeight) {
-//            inSampleSize = Math.round((float)height / (float)reqHeight);
-//        }
-//
-//        int expectedWidth = width / inSampleSize;
-//
-//        if (expectedWidth > reqWidth) {
-//            inSampleSize = Math.round((float)width / (float)reqWidth);
-//        }
-//
-//	    options.inSampleSize = inSampleSize;
-//	    options.inJustDecodeBounds = false;
-//
-//	    return BitmapFactory.decodeFile(path, options);
-		return null;
-	 }
-	
-	/**
-	 * Return the forum's bot configuration.
-	 */
-	public BotModeConfig getForumBotMode(ForumConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-forum-bot-mode", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			BotModeConfig botMode = new BotModeConfig();
-			botMode.parseXML(root);
-			return botMode;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Return the bot's voice configuration.
-	 */
-	public VoiceConfig getVoice(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-voice", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			VoiceConfig voice = new VoiceConfig();
-			voice.parseXML(root);
-			return voice;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Return the bot's default responses.
-	 */
-	public List<String> getDefaultResponses(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-default-responses", config.toXML());
-		List<String> defaultResponses = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return defaultResponses;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			defaultResponses.add(((Element)root.getChildNodes().item(index)).getChildNodes().item(0).getTextContent());
-		}
-		return defaultResponses;
-	}
-	
-	/**
-	 * Return the bot's greetings.
-	 */
-	public List<String> getGreetings(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-greetings", config.toXML());
-		List<String> greetings = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return greetings;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			greetings.add(((Element)root.getChildNodes().item(index)).getChildNodes().item(0).getTextContent());
-		}
-		return greetings;
-	}
-	
-	/**
-	 * Search the bot's responses.
-	 */
-	public List<ResponseConfig> getResponses(ResponseSearchConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-responses", config.toXML());
-		List<ResponseConfig> responses = new ArrayList<ResponseConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return responses;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			ResponseConfig response = new ResponseConfig();
-			response.parseXML((Element)root.getChildNodes().item(index));
-			responses.add(response);
-		}
-		return responses;
-	}
-	
-	/**
-	 * Search the bot's conversations.
-	 */
-	public List<ConversationConfig> getConversations(ResponseSearchConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-conversations", config.toXML());
-		List<ConversationConfig> conversations = new ArrayList<ConversationConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return conversations;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			ConversationConfig response = new ConversationConfig();
-			response.parseXML((Element)root.getChildNodes().item(index));
-			conversations.add(response);
-		}
-		return conversations;
-	}
-	
-	/**
-	 * Return the bot's learning configuration.
-	 */
-	public LearningConfig getLearning(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-learning", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			LearningConfig learning = new LearningConfig();
-			learning.parseXML(root);
-			return learning;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Return the list of content for the browse criteria.
-	 * The type defines the content type (one of Bot, Forum, Channel, Domain).
-	 */
-	public List<WebMediumConfig> browse(BrowseConfig config) {
-		config.addCredentials(this);
-		String type = "";
-		if (config.type.equals("Bot")) {
-			type = "/get-instances";
-		} else {
-			type = "/get-" + config.type.toLowerCase() + "s";
-		}
-		String xml = POST(this.url + type, config.toXML());
-		List<WebMediumConfig> instances = new ArrayList<WebMediumConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return instances;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			WebMediumConfig instance = null;
-			if (config.type.equals("Bot")) {
-				instance = new InstanceConfig();
-			} else if (config.type.equals("Forum")) {
-				instance = new ForumConfig();
-			} else if (config.type.equals("Channel")) {
-				instance = new ChannelConfig();
-			} else if (config.type.equals("Domain")) {
-				instance = new DomainConfig();
-			} else if (config.type.equals("Avatar")) {
-				instance = new AvatarConfig();
-			} else if (config.type.equals("Script")) {
-				instance = new ScriptConfig();
-			}else if (config.type.equals("Graphic")) {
-				instance = new GraphicConfig();
-			}
-			instance.parseXML((Element)root.getChildNodes().item(index));
-			instances.add(instance);
-		}
-		return instances;
-	}
-	
-	/**
-	 * Return the list of media for the avatar.
-	 */
-	public List<AvatarMedia> getAvatarMedia(AvatarConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-avatar-media", config.toXML());
-		List<AvatarMedia> instances = new ArrayList<AvatarMedia>();
-		Element root = parse(xml);
-		if (root == null) {
-			return instances;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			AvatarMedia instance = new AvatarMedia();
-			instance.parseXML((Element)root.getChildNodes().item(index));
-			instances.add(instance);
-		}
-		return instances;
-	}
-	
-	/**
-	 * Return the script source
-	 */
-	public ScriptSourceConfig getScriptSource(ScriptConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-script-source", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ScriptSourceConfig script = new ScriptSourceConfig();
-			script.parseXML(root);
-			return script;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Create or update script - Save the script source
-	 */
-	public void saveScriptSource(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-script-source", config.toXML());
-	}
-	
-	/**
-	 * Return the source code for a single bot script
-	 */
-	public ScriptSourceConfig getBotScriptSource(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-bot-script-source", config.toXML());
-		Element root = parse(xml);
-		if (root == null) {
-			return null;
-		}
-		try {
-			ScriptSourceConfig botScript = new ScriptSourceConfig();
-			botScript.parseXML(root);
-			return botScript;
-		} catch (Exception exception) {
-			this.exception = SDKException.parseFailure(exception);
-			throw this.exception;
-		}
-	}
-	
-	/**
-	 * Return a list of the bots scripts
-	 */
-	public List<ScriptConfig> getBotScripts(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-bot-scripts", config.toXML());
-		List<ScriptConfig> botScripts = new ArrayList<ScriptConfig>();
-		Element root = parse(xml);
-		if (root == null) {
-			return botScripts;
-		}
-		for (int i = 0; i < root.getChildNodes().getLength(); i++) {
-			ScriptConfig script = new ScriptConfig();
-			script.parseXML((Element)root.getChildNodes().item(i));
-			botScripts.add(script);
-		}
-		return botScripts;
-	}
-	/**
-	 * import a script to the bot
-	 */
-	
-	public void importBotScript(ScriptConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/import-bot-script", config.toXML());
-	}
-	
-	/**
-	 * import a chatlog/response list to the bot
-	 */
-	public void importBotLog(ScriptConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/import-bot-log", config.toXML());
-	}
-	
-	
-	/**
-	 * Save the bot script source
-	 */
-	public void saveBotScriptSource(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/save-bot-script-source", config.toXML());
-	}
-	
-	/**
-	 * Delete selected bot script
-	 */
-	public void deleteBotScript(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/delete-bot-script", config.toXML());
-	}
-	
-	/**
-	 * Move up one bot script
-	 */
-	public void upBotScript(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/up-bot-script", config.toXML());
-	}
-	
-	/**
-	 * Move down one bot script
-	 */
-	public void downBotScript(ScriptSourceConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/down-bot-script", config.toXML());
-	}
-	
-	/**
-	 * Return the list of content types.
-	 */
-	public String[] getTypes() {
-		return types;
-	}
-	
-	/**
-	 * Return the channel types.
-	 */
-	public String[] getChannelTypes() {
-		return channelTypes;
-	}
-	
-	/**
-	 * Return the access mode types.
-	 */
-	public String[] getAccessModes() {
-		return accessModes;
-	}
-	
-	/**
-	 * Return the media access mode types.
-	 */
-	public String[] getMediaAccessModes() {
-		return mediaAccessModes;
-	}
-	
-	/**
-	 * Return the learning mode types.
-	 */
-	public String[] getLearningModes() {
-		return learningModes;
-	}
-	
-	/**
-	 * Return the correction mode types.
-	 */
-	public String[] getCorrectionModes() {
-		return correctionModes;
-	}
-	
-	/**
-	 * Return the bot mode types.
-	 */
-	public String[] getBotModes() {
-		return botModes;
-	}
-	
-	/**
-	 * Return the current connected user.
-	 */
-	public UserConfig getUser() {
-		return user;
-	}
-	
-	/**
-	 * Set the current connected user.
-	 * connect() should be used to validate and connect a user.
-	 */
-	public void setUser(UserConfig user) {
-		this.user = user;
-	}
-	
-	/**
-	 * Return the current domain.
-	 * A domain is an isolated content space.
-	 */
-	public DomainConfig getDomain() {
-		return domain;
-	}
-	
-	/**
-	 * Set the current domain.
-	 * A domain is an isolated content space.
-	 * connect() should be used to validate and connect a domain.
-	 */
-	public void setDomain(DomainConfig domain) {
-		this.domain = domain;
-	}
-	
-	/**
-	 * Return the current application credentials.
-	 */
-	public Credentials getCredentials() {
-		return credentials;
-	}
-	
-	/**
-	 * Set the application credentials.
-	 */
-	public void setCredentials(Credentials credentials) {
-		this.credentials = credentials;
-		this.url = credentials.url;
-	}
-	
-	/**
-	 * Return is debugging has been enabled.
-	 */
-	public boolean isDebug() {
-		return debug;
-	}
-	
-	/**
-	 * Enable debugging, debug messages will be logged to System.out.
-	 */
-	public void setDebug(boolean debug) {
-		this.debug = debug;
-	}
-	
-	/**
-	 * Return the last thrown exception.
-	 */
-	public SDKException getException() {
-		return exception;
-	}
-
-	protected void setException(SDKException exception) {
-		this.exception = exception;
-	}
-
-	public String GET(String url) {
-		if (this.debug) {
-			System.out.println("GET: " + url);
-		}
-		String xml = null;
-		try {
-			HttpClient httpClient = new DefaultHttpClient();
-			HttpContext localContext = new BasicHttpContext();
-			HttpGet httpGet = new HttpGet(url);
-			HttpResponse response = httpClient.execute(httpGet, localContext);
-			HttpEntity entity = response.getEntity();
-			xml = EntityUtils.toString(entity, HTTP.UTF_8);
-
-			if (response.getStatusLine().getStatusCode() != 200) {
-				this.exception = new SDKException(""
-				   + response.getStatusLine().getStatusCode()
-				   + " : " + xml);
-				return "";
-			}
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-			this.exception = new SDKException(exception);
-			throw this.exception;
-		}
-		return xml;
-	}
-
-	public String POST(String url, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		try {
-			HttpClient httpClient = new DefaultHttpClient();
-			HttpContext localContext = new BasicHttpContext();
-			HttpPost httpPost = new HttpPost(url);
-
-			StringEntity content = new StringEntity(xml, "utf-8");
-			content.setContentType("application/xml");
-			httpPost.setEntity(content);
-
-			HttpResponse response = httpClient.execute(httpPost, localContext);
-
-			HttpEntity entity = response.getEntity();
-			if (entity != null) {
-				result = EntityUtils.toString(entity, HTTP.UTF_8);
-			}
-			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-				this.exception = new SDKException(""
-				   + response.getStatusLine().getStatusCode()
-				   + " : " + result);
-				throw this.exception;
-			}
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-			this.exception = new SDKException(exception);
-			throw this.exception;
-		}
-		return result;
-	}
-
-	public String POSTUpdate(Ability ability,String url, String xml) {
-		if (this.debug) {
-			System.out.println("POST: " + url);
-			System.out.println("XML: " + xml);
-		}
-		String result = "";
-		Response response = null;
-		try {
-			ClearableCookieJar cookieJar = new PersistentCookieJar(new SetCookieCache(),
-					new SharedPrefsCookiePersistor(ability));
-			OkHttpClient okHttpClient = new OkHttpClient.Builder()
-					.cookieJar(cookieJar)
-					.build();
-			response = getResponse(okHttpClient, url,xml);
-
-			if ((response.code() != 200) && (response.code() != 204)) {
-				this.exception = new SDKException(""
-						+ response.code()
-						+ " : " + response.body().toString());
-//				throw this.exception;
-			}
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-			this.exception = new SDKException(exception);
-//			throw this.exception;
-		}
-		return response.body().toString();
-	}
-
-	/**
-	 * This method is used to get cookies from response
-	 *
-	 * @param client OkHttpClient to get cookies from response
-	 * @param url Http URL
-	 */
-	public Response getResponse(OkHttpClient client, String url, String xml) {
-		// code request code here
-		MediaType mediaType = MediaType.parse("text/x-markdown; charset=utf-8");
-		String requestBody = xml;
-		Request request = new Request.Builder()
-				.url(url)
-				.post(RequestBody.create(mediaType, requestBody))
-				.build();
-		Call call = client.newCall(request);
-		try {
-			Response response = call.execute();
-			return response;
-		} catch (IOException e) {
-			e.printStackTrace();
-		}
-//		call.enqueue(new Callback() {
-//			@Override
-//			public void onFailure(Call call, IOException exception) {
-//			}
-//
-//			@Override
-//			public void onResponse(Call call, Response response) {
-//				if (response != null && response.body() != null) {
-//					List<String> cookieList = response.headers("Set-Cookie");
-//					StringBuilder stringBuilder = new StringBuilder();
-//					if (cookieList.size() > 0) {
-//						for (String cookie : cookieList) {
-//							stringBuilder.append(cookie).append(",");
-//						}
-//					}
-//					content[0] = response.body().toString();
-//				}
-//			}
-//		});
-		return null;
-	}
-	
-	public Element parse(String xml) {
-		if (this.debug) {
-			System.out.println(xml);
-		}
-		Document dom = null;
-		DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance();
-		try {
-			DocumentBuilder builder = factory.newDocumentBuilder();
-			InputSource source = new InputSource();
-			source.setCharacterStream(new StringReader(xml));
-			dom = builder.parse(source);
-			return dom.getDocumentElement();
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-			this.exception = new SDKException(exception.getMessage(), exception);
-			throw this.exception;
-		}
-	}
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * reInitialize
+     *
+     * @param config
+     * @return user
+     */
+    public ForumPostConfig create(ForumPostConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/create-forum-post", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            ForumPostConfig post = new ForumPostConfig();
+            post.parseXML(root);
+            return post;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * reInitialize
+     *
+     * @param config
+     * @return user
+     */
+    public IssueConfig create(IssueConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/create-issue", config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            IssueConfig issue = new IssueConfig();
+            issue.parseXML(root);
+            return issue;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * Fetch the content details from the server.
+     * The id or name and domain of the object must be set.
+     *
+     * @param <T>    t
+     * @param config
+     * @return config
+     */
+    @SuppressWarnings("unchecked")
+    public <T extends WebMediumConfig> T fetch(T config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/check-" + config.getType(), config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            config = (T) config.getClass().newInstance();
+            config.parseXML(root);
+            return config;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * Create the new content.
+     * The content will be returned with its new id.
+     *
+     * @param <T>    t
+     * @param config
+     * @return config
+     */
+    @SuppressWarnings("unchecked")
+    public <T extends WebMediumConfig> T create(T config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/create-" + config.getType(), config.toXML());
+        Element root = parse(xml);
+        if (root == null) {
+            return null;
+        }
+        try {
+            config = (T) config.getClass().newInstance();
+            config.parseXML(root);
+            return config;
+        } catch (Exception exception) {
+            this.exception = SDKException.parseFailure(exception);
+            throw this.exception;
+        }
+    }
+
+    /**
+     * Permanently delete the content with the id.
+     *
+     * @param config
+     */
+    public void delete(WebMediumConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-" + config.getType(), config.toXML());
+        if (this.domain != null && this.domain.id.equals(config.id) && config.getType().equals("domain")) {
+            domain = null;
+        }
+    }
+
+    /**
+     * Permanently delete the forum post with the id.
+     *
+     * @param config
+     */
+    public void delete(ForumPostConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-forum-post", config.toXML());
+    }
+
+    /**
+     * Permanently delete the issue with the id.
+     *
+     * @param config
+     */
+    public void delete(IssueConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-issue", config.toXML());
+    }
+
+    /**
+     * Permanently delete the response, greetings, or default response with the response id (and question id).
+     *
+     * @param config
+     */
+    public void delete(ResponseConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-response", config.toXML());
+    }
+
+    /**
+     * Permanently delete the avatar media.
+     *
+     * @param config
+     */
+    public void delete(AvatarMedia config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-avatar-media", config.toXML());
+    }
+
+    /**
+     * Permanently delete the avatar background.
+     *
+     * @param config
+     */
+    public void deleteAvatarBackground(AvatarConfig config) {
+        config.addCredentials(this);
+        POST(this.url + "/delete-avatar-background", config.toXML());
+    }
+
+    /**
+     * Return the bot's default responses.
+     *
+     * @param config
+     * @return defaultResponses
+     */
+    public List<String> getDefaultResponses(InstanceConfig config) {
+        config.addCredentials(this);
+        String xml = POST(this.url + "/get-default-responses", config.toXML());
+        List<String> defaultResponses = new ArrayList<String>();
+        Element root = parse(xml);
+        if (root == null) {
+            return defaultResponses;
+        }
+        for (int index = 0; index < root.getChildNodes().getLength(); index++) {
+            defaultResponses.add(((Element) root.getChildNodes().item(index)).getChildNodes().item(0).getTextContent());
+        }
+        return defaultResponses;
+    }
+
+
+    /**
+     * Return the bot's default responses.
+     *
+     * @return str
+     */
+    public String[] getAccessModes() {
+        return accessModes;
+    }
+
+    /**
+     * Return the bot's default responses.
+     *
+     * @return mediaAccessModes
+     */
+    public String[] getMediaAccessModes() {
+        return mediaAccessModes;
+    }
+
+
+    /**
+     * Return the current connected user.
+     *
+     * @return user
+     */
+    public UserConfig getUser() {
+        return user;
+    }
+
+    /**
+     * Set the current connected user.
+     * connect() should be used to validate and connect a user.
+     *
+     * @param user
+     */
+    public void setUser(UserConfig user) {
+        this.user = user;
+    }
+
+    /**
+     * Return the current domain.
+     * A domain is an isolated content space.
+     *
+     * @return domain
+     */
+    public DomainConfig getDomain() {
+        return domain;
+    }
+
+    /**
+     * Set the current domain.
+     * A domain is an isolated content space.
+     * connect() should be used to validate and connect a domain.
+     *
+     * @param domain
+     */
+    public void setDomain(DomainConfig domain) {
+        this.domain = domain;
+    }
+
+    /**
+     * Return the current application credentials.
+     *
+     * @return credentials
+     */
+    public Credentials getCredentials() {
+        return credentials;
+    }
+
+    /**
+     * Set the application credentials.
+     *
+     * @param credentials
+     */
+    public void setCredentials(Credentials credentials) {
+        this.credentials = credentials;
+        this.url = credentials.url;
+    }
+
+
+    /**
+     * Enable debugging, debug messages will be logged to System.out.
+     *
+     * @param debug
+     */
+    public void setDebug(boolean debug) {
+        this.debug = debug;
+    }
+
+    /**
+     * Return the last thrown exception.
+     *
+     * @return exception
+     */
+    public SDKException getException() {
+        return exception;
+    }
+
+    /**
+     * POST
+     *
+     * @param url
+     * @param xml
+     * @return response
+     */
+    public String POST(String url, String xml) {
+        if (this.debug) {
+            System.out.println("POST: " + url);
+            System.out.println("XML: " + xml);
+        }
+        String result = "";
+        try {
+            HttpClient httpClient = new DefaultHttpClient();
+            HttpContext localContext = new BasicHttpContext();
+            HttpPost httpPost = new HttpPost(url);
+
+            StringEntity content = new StringEntity(xml, "utf-8");
+            content.setContentType("application/xml");
+            httpPost.setEntity(content);
+
+            HttpResponse response = httpClient.execute(httpPost, localContext);
+
+            HttpEntity entity = response.getEntity();
+            if (entity != null) {
+                result = EntityUtils.toString(entity, HTTP.UTF_8);
+            }
+            if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
+                this.exception = new SDKException(""
+                        + response.getStatusLine().getStatusCode()
+                        + " : " + result);
+                throw this.exception;
+            }
+        } catch (Exception exception) {
+            if (this.debug) {
+                exception.printStackTrace();
+            }
+            this.exception = new SDKException(exception);
+            throw this.exception;
+        }
+        return result;
+    }
+
+    /**
+     * reInitialize
+     *
+     * @param ability
+     * @param url
+     * @param xml
+     * @return response
+     */
+    public String POSTUpdate(Ability ability, String url, String xml) {
+        if (this.debug) {
+            System.out.println("POST: " + url);
+            System.out.println("XML: " + xml);
+        }
+        String result = "";
+        Response response = null;
+        try {
+            ClearableCookieJar cookieJar = new PersistentCookieJar(new SetCookieCache(),
+                    new SharedPrefsCookiePersistor(ability));
+            OkHttpClient okHttpClient = new OkHttpClient.Builder()
+                    .cookieJar(cookieJar)
+                    .build();
+            response = getResponse(okHttpClient, url, xml);
+
+            if ((response.code() != 200) && (response.code() != 204)) {
+                this.exception = new SDKException(""
+                        + response.code()
+                        + " : " + response.body().toString());
+            }
+        } catch (Exception exception) {
+            if (this.debug) {
+                exception.printStackTrace();
+            }
+            this.exception = new SDKException(exception);
+        }
+        return response.body().toString();
+    }
+
+    /**
+     * This method is used to get cookies from response
+     *
+     * @param client OkHttpClient to get cookies from response
+     * @param url    Http URL
+     * @param xml
+     * @return response
+     */
+    public Response getResponse(OkHttpClient client, String url, String xml) {
+        // code request code here
+        MediaType mediaType = MediaType.parse("text/x-markdown; charset=utf-8");
+        String requestBody = xml;
+        Request request = new Request.Builder()
+                .url(url)
+                .post(RequestBody.create(mediaType, requestBody))
+                .build();
+        Call call = client.newCall(request);
+        try {
+            Response response = call.execute();
+            return response;
+        } catch (IOException e) {
+            e.printStackTrace();
+        }
+        return null;
+    }
+
+    /**
+     * parse
+     *
+     * @param xml
+     * @return user
+     */
+
+    public Element parse(String xml) {
+        if (this.debug) {
+            System.out.println(xml);
+        }
+        Document dom = null;
+        return (Element) new ShapeElement();
+    }
 }
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
similarity index 96%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
index 970f2a92749f7473abfbd8dc5d844b56a0f86545..47bfcd33e18f1f92a9ce21261dd9a14a90c4b9f4 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
@@ -13,21 +13,8 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.ChatConfig;
-import org.botlibre.sdk.config.ChatResponse;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.VoiceConfig;
-import org.botlibre.sdk.provider.ChatListProvicer;
-import org.botlibre.sdk.util.LogUtils;
-import org.botlibre.sdk.util.PreferencesUtils;
-import org.botlibre.sdk.util.ResUtils;
-import org.botlibre.sdk.util.ShapeUtils;
-import org.botlibre.sdk.util.ToastUtils;
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
@@ -72,6 +59,19 @@ import ohos.security.SystemPermission;
 import ohos.utils.PacMap;
 import ohos.utils.zson.ZSONArray;
 import ohos.utils.zson.ZSONObject;
+import org.botlibre.sdk.MainAbility;
+import org.botlibre.sdk.ResourceTable;
+import org.botlibre.sdk.config.AvatarConfig;
+import org.botlibre.sdk.config.ChatConfig;
+import org.botlibre.sdk.config.ChatResponse;
+import org.botlibre.sdk.config.InstanceConfig;
+import org.botlibre.sdk.config.VoiceConfig;
+import org.botlibre.sdk.provider.ChatListProvicer;
+import org.botlibre.sdk.util.LogUtils;
+import org.botlibre.sdk.util.PreferencesUtils;
+import org.botlibre.sdk.util.ResUtils;
+import org.botlibre.sdk.util.ShapeUtils;
+import org.botlibre.sdk.util.ToastUtils;
 
 import java.util.ArrayList;
 import java.util.Arrays;
@@ -84,20 +84,26 @@ import static ohos.bundle.IBundleManager.PERMISSION_GRANTED;
 
 
 /**
- * Ability for chatting with a bot.
- * To launch this Ability from your app you can use the HttpFetchAction passing the bot id or name as a config, and launch=true.
+ * ChatAbility
+ *
+ * @since 2021-04-16
  */
-@SuppressWarnings("deprecation")
 public class ChatAbility extends LibreAbility {
 
+    /**
+     * ability
+     */
+    private static Ability ability;
     private static final int ASR_RESULT = 9;
     private static final int BEGIN_SPEECH = 10;
     private static final int END_SPEECH = 11;
     private static final int AUTO_RESPONSE = 12;
-    protected static boolean DEBUG;
-    public static Ability ability;
-
 
+    /**
+     * videoLayout
+     */
+    private Component videoLayout;
+    public Image bigImage;
     private DirectionalLayout directionYes;
     private DirectionalLayout directionSelect;
     private DirectionalLayout directionType;
@@ -107,8 +113,8 @@ public class ChatAbility extends LibreAbility {
     private Button buttonBig;
     private Button buttonType;
     private Text textInfo;
-    private DirectionalLayout menuMLayout;
-    private DirectionalLayout chatCLayout;
+    private DirectionalLayout menuLayout;
+    private DirectionalLayout chatLayout;
     private DirectionalLayout responseLayout;
     private DirectionalLayout chatToolBar;
     private Button menuButton;
@@ -119,8 +125,6 @@ public class ChatAbility extends LibreAbility {
     private WebView webView;
     private Button soundButton;
     private ListContainer scrollView;
-    public Component videoLayout;
-    public Image bigImage;
     protected TextField editText;
 
 
@@ -327,7 +331,7 @@ public class ChatAbility extends LibreAbility {
          */
         @Override
         public void onSpeechStart(String s) {
-            runUI(new Runnable() {
+            runUi(new Runnable() {
                 @Override
                 public void run() {
                     micButton.setEnabled(false);
@@ -351,7 +355,7 @@ public class ChatAbility extends LibreAbility {
          */
         @Override
         public void onSpeechFinish(String s) {
-            runUI(new Runnable() {
+            runUi(new Runnable() {
                 @Override
                 public void run() {
                     micButton.setEnabled(true);
@@ -405,7 +409,7 @@ public class ChatAbility extends LibreAbility {
          */
         @Override
         public void onEndOfSpeech() {
-            debug("onEndOfSpeech:");
+            //debug("onEndOfSpeech:");
             LogUtils.sop("onSpeechFinish");
             mainHandler.sendEvent(END_SPEECH);
         }
@@ -416,7 +420,7 @@ public class ChatAbility extends LibreAbility {
          */
         @Override
         public void onError(int error) {
-            LogUtils.sop("ChatActivity on error executes here!");
+            LogUtils.sop("ChatAbility on error executes here!");
             try {
                 if (error == AsrError.ERROR_AUDIO) {
                     LogUtils.sop("Error: Audio Recording Error");
@@ -490,7 +494,7 @@ public class ChatAbility extends LibreAbility {
     @Override
     protected void onStart(Intent intent) {
         super.onStart(intent);
-        super.setUIContent(ResourceTable.Layout_activity_chat);
+        super.setUIContent(ResourceTable.Layout_ability_chat);
         ability = this;
         //clear the messages from the listView -
         messages.clear();
@@ -498,7 +502,7 @@ public class ChatAbility extends LibreAbility {
         //set/Save the current volume from the device.
         //setStreamVolume();
         //Music Volume is Enabled.
-        audioManager=new AudioManager(this);
+        audioManager = new AudioManager(this);
         if (MainAbility.sound) {
             audioManager.setVolume(AudioManager.AudioVolumeType.STREAM_MUSIC, 5);
         } else {
@@ -534,8 +538,8 @@ public class ChatAbility extends LibreAbility {
 
         //scrollVie added and stuff
         scrollView = (ListContainer) findComponentById(ResourceTable.Id_chatList);
-        menuMLayout = (DirectionalLayout) findComponentById(ResourceTable.Id_menuMLayout);
-        chatCLayout = (DirectionalLayout) findComponentById(ResourceTable.Id_chatCLayout);
+        menuLayout = (DirectionalLayout) findComponentById(ResourceTable.Id_menuMLayout);
+        chatLayout = (DirectionalLayout) findComponentById(ResourceTable.Id_chatCLayout);
         responseLayout = (DirectionalLayout) findComponentById(ResourceTable.Id_responseLayout);
         chatToolBar = (DirectionalLayout) findComponentById(ResourceTable.Id_chatToolBar);
         listContainer = (ListContainer) findComponentById(ResourceTable.Id_chatList);
@@ -653,8 +657,8 @@ public class ChatAbility extends LibreAbility {
             switch (stateLayouts) {
                 case 0:
                     scrollView.setVisibility(Component.VISIBLE);
-                    chatCLayout.setVisibility(Component.VISIBLE);
-                    menuMLayout.setVisibility(Component.VISIBLE);
+                    chatLayout.setVisibility(Component.VISIBLE);
+                    menuLayout.setVisibility(Component.VISIBLE);
                     responseLayout.setVisibility(Component.VISIBLE);
                     chatToolBar.setVisibility(Component.VISIBLE);
                     break;
@@ -666,8 +670,8 @@ public class ChatAbility extends LibreAbility {
                     chatToolBar.setVisibility(Component.HIDE);
                     break;
                 case 3:
-                    menuMLayout.setVisibility(Component.HIDE);
-                    chatCLayout.setVisibility(Component.HIDE);
+                    menuLayout.setVisibility(Component.HIDE);
+                    chatLayout.setVisibility(Component.HIDE);
                     break;
             }
             stateLayouts++;
@@ -681,8 +685,8 @@ public class ChatAbility extends LibreAbility {
             switch (stateLayouts) {
                 case 0:
                     scrollView.setVisibility(Component.VISIBLE);
-                    chatCLayout.setVisibility(Component.VISIBLE);
-                    menuMLayout.setVisibility(Component.VISIBLE);
+                    chatLayout.setVisibility(Component.VISIBLE);
+                    menuLayout.setVisibility(Component.VISIBLE);
                     responseLayout.setVisibility(Component.VISIBLE);
                     chatToolBar.setVisibility(Component.VISIBLE);
                     break;
@@ -694,8 +698,8 @@ public class ChatAbility extends LibreAbility {
                     chatToolBar.setVisibility(Component.HIDE);
                     break;
                 case 3:
-                    menuMLayout.setVisibility(Component.HIDE);
-                    chatCLayout.setVisibility(Component.HIDE);
+                    menuLayout.setVisibility(Component.HIDE);
+                    chatLayout.setVisibility(Component.HIDE);
                     break;
             }
             stateLayouts++;
@@ -1053,7 +1057,7 @@ public class ChatAbility extends LibreAbility {
         ttsClient = TtsClient.getInstance();
         ttsClient.create(this, ttsListener);
 
-        if(asrClient!=null){
+        if (asrClient != null) {
             asrClient.stopListening();
             asrClient.cancel();
             asrClient.destroy();
@@ -1135,7 +1139,7 @@ public class ChatAbility extends LibreAbility {
     protected void onInactive() {
         //stopListening();
         //muteMicBeep(false);
-        if(asrClient!=null){
+        if (asrClient != null) {
             asrClient.stopListening();
             asrClient.cancel();
             asrClient.destroy();
@@ -1153,7 +1157,7 @@ public class ChatAbility extends LibreAbility {
 
 
     private void stopListening() {
-        debug("stopListening");
+        //debug("stopListening");
         try {
             // muteMicBeep(false);
             isListening = false;
@@ -1165,7 +1169,7 @@ public class ChatAbility extends LibreAbility {
     }
 
     private void restartListening() {
-        debug("restartListening");
+        //debug("restartListening");
         if (!MainAbility.listenInBackground) {
             return;
         }
@@ -1187,9 +1191,6 @@ public class ChatAbility extends LibreAbility {
     }
 
     public void debug(final String text) {
-        if (!DEBUG) {
-            return;
-        }
         ChatResponse ready = new ChatResponse();
         ready.message = text;
         messages.add(ready);
@@ -1230,7 +1231,7 @@ public class ChatAbility extends LibreAbility {
 
     private void beginListening() {
         setStreamVolume();
-        debug("beginListening:");
+        //debug("beginListening:");
         try {
             if (!MainAbility.handsFreeSpeech) {
                 return;
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
similarity index 79%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
index 69900c2c8b8bb2f3e8d3e25a5e2c36890a09ee8c..63240aa8538946628a31a27f795a03b6cf0f66da 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
@@ -13,10 +13,10 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpCreateUserAction;
+import org.botlibre.sdk.ability.actions.HttpCreateUserAction;
 import org.botlibre.sdk.config.UserConfig;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
@@ -25,30 +25,31 @@ import ohos.agp.components.Component;
 import ohos.agp.components.TextField;
 
 /**
- * Ability for creating a new user.
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
  */
 public class CreateUserAbility extends LibreAbility {
     @Override
     public void onStart(Intent intent) {
         super.onStart(intent);
-//        setContentView(R.layout.Ability_create_user);
         super.setUIContent(ResourceTable.Layout_ability_create_user);
 
-        Button createButton = (Button)findComponentById(ResourceTable.Id_createButton);
+        Button createButton = (Button) findComponentById(ResourceTable.Id_createButton);
         createButton.setClickedListener(new Component.ClickedListener() {
             @Override
             public void onClick(Component component) {
                 create();
             }
         });
-	}
-    
+    }
+
     /**
      * Create the user.
      */
     public void create() {
-    	UserConfig config = new UserConfig();
-    	
+        UserConfig config = new UserConfig();
+
         TextField text = (TextField) findComponentById(ResourceTable.Id_userText);
         config.user = text.getText().toString().trim();
         text = (TextField) findComponentById(ResourceTable.Id_passwordText);
@@ -63,17 +64,17 @@ public class CreateUserAbility extends LibreAbility {
         config.website = text.getText().toString().trim();
         text = (TextField) findComponentById(ResourceTable.Id_bioText);
         config.bio = text.getText().toString().trim();
-        Checkbox checkbox = (Checkbox)findComponentById(ResourceTable.Id_showNameCheckBox);
-		config.showName = checkbox.isChecked();
-        
-    	HttpCreateUserAction action = new HttpCreateUserAction(getContext(),this, config);
-    	action.execute();
+        Checkbox checkbox = (Checkbox) findComponentById(ResourceTable.Id_showNameCheckBox);
+        config.showName = checkbox.isChecked();
+
+        HttpCreateUserAction action = new HttpCreateUserAction(getContext(), this, config);
+        action.execute();
     }
-    
+
     /**
      * Cancel
      */
     public void cancel() {
-    	terminateAbility();
+        terminateAbility();
     }
 }
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
similarity index 65%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
index f4eb0b80dbffca796f6c7098f838927de0c061d3..d40cf6eb4d977b0c0eb3c2a95df0303cd46c3b10 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
@@ -13,30 +13,26 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability;
 
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
 import ohos.aafwk.content.Operation;
+import ohos.eventhandler.EventHandler;
+import ohos.eventhandler.EventRunner;
 
-public abstract class HttpResultAction{
-    protected Ability ability;
-    protected Exception exception;
-
-    public HttpResultAction(Ability ability) {
-        this.ability = ability;
-    }
-
-    public Exception getException() {
-        return exception;
-    }
-
-    public void setException(Exception exception) {
-        this.exception = exception;
-    }
+/**
+ * LibreAbility
+ *
+ * @since 2021-04-16
+ */
+public abstract class LibreAbility extends Ability {
 
     /**
-     * 启动activity
+     * 启动ability
+     *
+     * @param ability
+     * @param name
      */
     public void startOpenAbility(Ability ability, String name) {
         Intent intent = new Intent();
@@ -46,13 +42,17 @@ public abstract class HttpResultAction{
                 .withAbilityName(name)
                 .build();
         intent.setOperation(operation);
-        ability.startAbility(intent);
+        startAbility(intent);
     }
 
     /**
-     * 启动activity
+     * 启动ability
+     *
+     * @param ability
+     * @param name
+     * @return intent
      */
-    public void startOpenAbilityForResult(Ability ability, String name, int requestCode) {
+    public Intent getIntent(Ability ability, String name) {
         Intent intent = new Intent();
         Operation operation = new Intent.OperationBuilder()
                 .withDeviceId("")
@@ -60,6 +60,18 @@ public abstract class HttpResultAction{
                 .withAbilityName(name)
                 .build();
         intent.setOperation(operation);
-        ability.startAbilityForResult(intent, requestCode);
+        return intent;
     }
-}
\ No newline at end of file
+
+    /**
+     * 主线程执行任务
+     *
+     * @param runnable
+     */
+    public static void runUi(Runnable runnable) {
+        EventHandler eventHandler = new EventHandler(EventRunner.getMainEventRunner());
+        eventHandler.postSyncTask(runnable);
+
+    }
+
+}
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
similarity index 99%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
index 8f7300e4b2a285bd14aadfabd71c6eb19d8721fa..184f900a194a49a2eb00c60a1b96e20a87e5b975 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
@@ -12,7 +12,7 @@
  * See the License for the specific language governing permissions and
  * limitations under the License.
  */
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import java.util.ArrayList;
 import java.util.List;
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
similarity index 94%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
index d6f8ac1e79231f3a9e991158893602fadb6d73a3..87dbbd6d63459b31cc92cdd5b50d351bbc2b4302 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
@@ -13,9 +13,9 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.activityy.actions.HttpConnectAction;
+import org.botlibre.sdk.ability.actions.HttpConnectAction;
 import org.botlibre.sdk.config.UserConfig;
 import org.botlibre.sdk.ResourceTable;
 import ohos.aafwk.content.Intent;
@@ -31,7 +31,6 @@ public class LoginAbility extends LibreAbility implements Component.ClickedListe
 	@Override
 	public void onStart(Intent intent) {
 		super.onStart(intent);
-//		setContentView(R.layout.Ability_login);
 		super.setUIContent(ResourceTable.Layout_ability_login);
 
 		Button connectButton = (Button)findComponentById(ResourceTable.Id_connectButton);
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/MicConfigAbility.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/MicConfigAbility.java
similarity index 79%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/MicConfigAbility.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/MicConfigAbility.java
index 9100d125d49906e5c398f35c6b153a3ae4a4e888..bd3933af1174f46c98eeffd8b462c73126f285e9 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/MicConfigAbility.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/MicConfigAbility.java
@@ -12,7 +12,7 @@
  * See the License for the specific language governing permissions and
  * limitations under the License.
  */
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 
 import com.czt.mp3recorder.MP3Recorder;
@@ -54,17 +54,13 @@ import static ohos.bundle.IBundleManager.PERMISSION_GRANTED;
 
 
 public class MicConfigAbility extends LibreAbility implements AsrListener {
-    //Name - used for Log.d(classname, "")
     private final String CLASSNAME = "MicConfiguration";
 
 
     public boolean active;
-    private boolean isRecording;
-    private double lastReply = System.currentTimeMillis();
     private Button nextButton;
     private Text txt;
     private boolean failedOfflineLanguage = false;
-    private int counter = 0;
     private TextField editTextForGoogle, editTextSpeech;
     private Image micButton;
 
@@ -116,7 +112,7 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
         textOption = (Text) findComponentById(ResourceTable.Id_textOption);
 
         ckOfflineSpeech.setChecked(MainAbility.offlineSpeech);
-        ckDebug.setChecked(ChatAbility.DEBUG);
+        ckDebug.setChecked(false);
 
         //disabling buttons for recording sound
         playButton.setEnabled(false);
@@ -146,21 +142,17 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
         ckDebug.setCheckedStateChangedListener((absButton, b) -> {
             Preferences cookies = PreferencesUtils.getPreferences(this);
             if (b) {
-                ChatAbility.DEBUG = true;
                 cookies.putBoolean("debug", true);
                 cookies.flushSync();
                 return;
             }
             //else
-            ChatAbility.DEBUG = false;
             cookies.putBoolean("debug", false);
             cookies.flushSync();
         });
         micButton.setClickedListener(component -> {
             if (txt.getText().equals("Status: Timeout!")) {
-                //Intent intent = getIntent();
                 terminateAbility();
-                // startActivity(intent);
                 return;
             }
             if (clicked) {
@@ -169,7 +161,6 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
                 txt.setText("Status: Loading...");
                 micButton.setEnabled(false);
                 active = true;
-                lastReply = System.currentTimeMillis();
             }
         });
         micButton1.setClickedListener(component -> {
@@ -178,17 +169,6 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
         micButton2.setClickedListener(component -> {
             txt.setText("Status: ON");
             setMicIcon(true, false);
-//            Intent intent = new Intent(RecognizerIntent.ACTION_RECOGNIZE_SPEECH);
-//            intent.putExtra(RecognizerIntent.EXTRA_LANGUAGE_MODEL, MainActivity.voice.language);
-//            try {
-//                startActivityForResult(intent, 1);
-//                editTextForGoogle.setText("");
-//            } catch (ActivityNotFoundException a) {
-//                Toast t = Toast.makeText(getApplicationContext(),
-//                        "Your device doesn't support Speech to Text",
-//                        Toast.LENGTH_SHORT);
-//                t.show();
-//            }
         });
         playButton.setClickedListener(component -> {
             try {
@@ -423,7 +403,7 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
             e.printStackTrace();
         }
         if (volume != 0) {
-            LogUtils.e("ChatActivity", "The volume changed and saved to : " + volume);
+            LogUtils.e("ChatAbility", "The volume changed and saved to : " + volume);
             MainAbility.volume = volume;
         }
     }
@@ -454,26 +434,6 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
         return deleted;
     }
 
-
-//    @Override
-//    protected void onActivityResult(int requestCode, int resultCode, Intent data) {
-//        super.onActivityResult(requestCode, resultCode, data);
-//
-//        switch (requestCode) {
-//
-//            case 1: {
-//                if (resultCode == RESULT_OK && data != null) {
-//                    setMicIcon(false, false);
-//                    ArrayList<String> text = data.getStringArrayListExtra(RecognizerIntent.EXTRA_RESULTS);
-//                    editTextForGoogle.setText(text.get(0));
-//                    txt.setText("Status: Done!");
-//                }
-//                break;
-//            }
-//        }
-//    }
-
-
     @Override
     public void onInit(PacMap pacMap) {
 
@@ -482,10 +442,8 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
     @Override
     public void onBeginningOfSpeech() {
         txt.setText("Status: Recording...");
-        lastReply = System.currentTimeMillis();
-        isRecording = true;
 
-        runUI(new Runnable() {
+        runUi(new Runnable() {
             @Override
             public void run() {
                 setMicIcon(true, true);
@@ -500,9 +458,7 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
     @Override
     public void onEndOfSpeech() {
         txt.setText("Status: Done!");
-        lastReply = System.currentTimeMillis();
-        isRecording = false;
-        runUI(new Runnable() {
+        runUi(new Runnable() {
             @Override
             public void run() {
                 setMicIcon(false, false);
@@ -513,29 +469,11 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
         muteMicBeep(false);
     }
 
-    private void restartListening() {
-        lastReply = System.currentTimeMillis();
-        if (!active) {
-            setMicIcon(false, false);
-            return;
-        }
-        runUI(new Runnable() {
-            public void run() {
-                try {
-                    beginListening();
-                } catch (Exception e) {
 
-                }
-            }
-        });
-    }
 
     @Override
     public void onError(int error) {
-        isRecording = false;
-
-        lastReply = System.currentTimeMillis();
-        runUI(new Runnable() {
+        runUi(new Runnable() {
             @Override
             public void run() {
                 setMicIcon(false, false);
@@ -605,46 +543,6 @@ public class MicConfigAbility extends LibreAbility implements AsrListener {
         }
     }
 
-    private void beginListening() {
-        setStreamVolume();
-        lastReply = System.currentTimeMillis();
-
-        muteMicBeep(true);
-//        Intent intent = new Intent(RecognizerIntent.ACTION_RECOGNIZE_SPEECH);
-//        if (MainActivity.offlineSpeech) {
-//            intent.putExtra(RecognizerIntent.EXTRA_LANGUAGE_MODEL, MainActivity.voice.language);
-//
-//            if (!this.failedOfflineLanguage) {
-//                //en-US will use the English in offline.
-//                intent.putExtra(RecognizerIntent.EXTRA_LANGUAGE, "en-US");
-//                // intent.putExtra(RecognizerIntent.EXTRA_PREFER_OFFLINE, true);
-//            }
-//            intent.putExtra(RecognizerIntent.EXTRA_PREFER_OFFLINE, true);
-//        } else {
-//            if (MainActivity.voice.language != null && !MainActivity.voice.language.isEmpty()) {
-//                intent.putExtra(RecognizerIntent.EXTRA_LANGUAGE_MODEL, MainActivity.voice.language);
-//                if (!this.failedOfflineLanguage) {
-//                    intent.putExtra(RecognizerIntent.EXTRA_LANGUAGE, MainActivity.voice.language);
-//                }
-//            } else {
-//                intent.putExtra(RecognizerIntent.EXTRA_LANGUAGE_MODEL, "en");
-//                if (!this.failedOfflineLanguage) {
-//                    intent.putExtra(RecognizerIntent.EXTRA_LANGUAGE, "en");
-//                }
-//            }
-//        }
-//
-//        try {
-//            LogUtils.e("BeginListening", "StartListening");
-//            this.asrClient.startListening(intent);
-//            setMicIcon(true, false);
-//        } catch (ActivityNotFoundException a) {
-//            LogUtils.e("BeginListening", "CatchError: " + a.getMessage());
-//            ToastUtils.show(this,"Your device doesn't support Speech to Text");
-//            txt.setText("Status: Your device doesn't support Speech to text.");
-//        }
-    }
-
     @Override
     protected void onStop() {
         super.onStop();
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
similarity index 36%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
index 2d496ba8aa89d50db08635aad88c62c07416b3a0..a63963b00c9eae5907bcaf9920b846b56e28d05e 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
@@ -13,15 +13,54 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability.actions;
 
+import org.botlibre.sdk.util.AsyncTask;
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
+import ohos.aafwk.content.Operation;
 
-public class BaseAbility extends Ability {
-    @Override
-    public void onStart(Intent intent) {
-        super.onStart(intent);
+/**
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
+ */
+public abstract class HttpAction extends AsyncTask<Void, Void, String> {
+    protected Ability ability;
+    protected Exception exception;
+
+    /**
+     * HttpAction
+     *
+     * @param ability
+     */
+    public HttpAction(Ability ability) {
+        this.ability = ability;
+    }
+
+    public Exception getException() {
+        return exception;
+    }
+
+    public void setException(Exception exception) {
+        this.exception = exception;
     }
 
-}
+    /**
+     * getIntent
+     *
+     * @param abilit
+     * @param name
+     * @param requestCode
+     */
+    public void startOpenAbilityForResult(Ability abilit, String name, int requestCode) {
+        Intent intent = new Intent();
+        Operation operation = new Intent.OperationBuilder()
+                .withDeviceId("")
+                .withBundleName(abilit.getBundleName())
+                .withAbilityName(name)
+                .build();
+        intent.setOperation(operation);
+        abilit.startAbilityForResult(intent, requestCode);
+    }
+}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
similarity index 56%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
index ec1bb7b80b09686bf035ab5d730d38db2da668dd..951dd3fa42fe7a242a9671f5e4d4323c3683160e 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
@@ -13,8 +13,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.actions;
-
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.UserConfig;
@@ -22,10 +21,22 @@ import org.botlibre.sdk.util.PreferencesUtils;
 import ohos.aafwk.ability.Ability;
 import ohos.data.preferences.Preferences;
 
+/**
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
+ */
 public class HttpConnectAction extends HttpUIAction {
     UserConfig config;
     boolean finish;
 
+    /**
+     * HttpConnectAction
+     *
+     * @param ability
+     * @param config
+     * @param finish
+     */
     public HttpConnectAction(Ability ability, UserConfig config, boolean finish) {
         super(ability);
         this.config = config;
@@ -34,11 +45,7 @@ public class HttpConnectAction extends HttpUIAction {
 
     @Override
     protected String doInBackground(Void... params) {
-        try {
-            this.config = MainAbility.connection.connect(config);
-        } catch (Exception exception) {
-            this.exception = exception;
-        }
+        this.config = MainAbility.connection.connect(config);
         return "";
     }
 
@@ -48,31 +55,19 @@ public class HttpConnectAction extends HttpUIAction {
         if (this.exception != null) {
             return;
         }
-        try {
-            MainAbility.user = this.config;
-            if (this.ability instanceof MainAbility) {
-                ((MainAbility) this.ability).resetView();
-            }
-
-            if (this.finish) {
-
-                Preferences cookies = PreferencesUtils.getPreferences(ability);
-                cookies.putString("user", MainAbility.user.user);
-                cookies.putString("token", MainAbility.user.token);
-                cookies.flushSync();
-
-                this.ability.terminateAbility();
-            }
+        MainAbility.user = this.config;
+        if (this.ability instanceof MainAbility) {
+            ((MainAbility) this.ability).resetView();
+        }
 
-        } catch (Exception error) {
-            this.exception = error;
-            MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
+        if (this.finish) {
 
-            Preferences cookies=PreferencesUtils.getPreferences(this.ability);
-            cookies.putString("user", null);
-            cookies.putString("token", null);
+            Preferences cookies = PreferencesUtils.getPreferences(ability);
+            cookies.putString("user", MainAbility.user.user);
+            cookies.putString("token", MainAbility.user.token);
             cookies.flushSync();
-            return;
+
+            this.ability.terminateAbility();
         }
     }
 
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
similarity index 57%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
index 2ee16be891bfc11c254fbc70a3899e81d11ae153..0d8dac226f0c4e85c637ef5a06fed54b64b8c5fa 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
@@ -13,48 +13,48 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.actions;
-
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.UserConfig;
 import ohos.aafwk.ability.Ability;
+import ohos.app.Context;
 
-public class HttpChangeUserIconAction extends HttpUIAction {
-
+/**
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
+ */
+public class HttpCreateUserAction extends HttpUIAction {
     UserConfig config;
-    String file;
-
-    public HttpChangeUserIconAction(Ability ability, String file, UserConfig config) {
+    private Context context;
+
+    /**
+     * HttpCreateUserAction
+     *
+     * @param context
+     * @param ability
+     * @param config
+     */
+    public HttpCreateUserAction(Context context, Ability ability, UserConfig config) {
         super(ability);
         this.config = config;
-        this.file = file;
+        this.context = context;
     }
 
     @Override
     protected String doInBackground(Void... params) {
-        try {
-            this.config = MainAbility.connection.updateIcon(this.file, this.config);
-        } catch (Exception exception) {
-            this.exception = exception;
+        this.config = MainAbility.connection.create(ability, this.config);
+        if (this.exception != null) {
+            return "";
         }
+        MainAbility.user = this.config;
+        this.ability.terminateAbility();
         return "";
     }
 
     @Override
     public void onPostExecute(String xml) {
         super.onPostExecute(xml);
-        if (this.exception != null) {
-            return;
-        }
-        try {
-            MainAbility.user = this.config;
-            MainAbility.viewUser = this.config;
-//            ((ViewUserAbility) this.ability).resetView();
-        } catch (Exception error) {
-            this.exception = error;
-            MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-            return;
-        }
     }
 }
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
similarity index 37%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
index 10a080c46ddb4ab0b94f51ba773a3eec5e1d3b36..7243c694826d95bc389a7e9b594136d52d2f1bff 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
@@ -13,7 +13,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
@@ -28,57 +28,61 @@ import ohos.agp.window.service.DisplayManager;
 
 import java.util.Optional;
 
+/**
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
+ */
 public abstract class HttpUIAction extends HttpAction {
-	protected CommonDialog dialog;
+    protected CommonDialog dialog;
+
+    public HttpUIAction(Ability Ability) {
+        super(Ability);
+    }
+
+    @Override
+    protected void onPreExecute() {
+        try {
+            Optional<Display>
+                    display = DisplayManager.getInstance().getDefaultDisplay(ability.getContext());
+            DisplayAttributes displayAttributes = display.get().getAttributes();
+            DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability.getContext()).
+                    parse(ResourceTable.Layout_loading_dialog,
+                            null, false);
+            this.dialog = new CommonDialog(this.ability);
+            this.dialog.setContentCustomComponent(layout);
+            this.dialog.setAutoClosable(false);
+            this.dialog.setSize(displayAttributes.width - 100, 150);
+            this.dialog.show();
+        } catch (Exception exception) {
+            LogUtils.e("HttpUIAction.onPreExecute", exception.toString());
+        }
+    }
 
-	public HttpUIAction(Ability Ability) {
-		super(Ability);
-	}
-	
-	@Override
-	protected void onPreExecute() {
-		try {
-			Optional<Display>
-					display = DisplayManager.getInstance().getDefaultDisplay(ability.getContext());
-			DisplayAttributes displayAttributes = display.get().getAttributes();
-			DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability.getContext()).
-					parse(ResourceTable.Layout_loading_dialog,
-							null, false);
-			this.dialog = new CommonDialog(this.ability);
-			this.dialog.setContentCustomComponent(layout);
-			this.dialog.setAutoClosable(false);
-			this.dialog.setSize(displayAttributes.width - 100,150);
-//			this.dialog.setContentText("Processing...");
-			this.dialog.show();
-		} catch (Exception exception) {
-			LogUtils.e("HttpUIAction.onPreExecute", exception.toString());
-		}
-	}
-	
-	@Override
-	protected void onPostExecute(String result) {
-		try {
-			if (this.dialog != null) {
-				this.dialog.destroy();
-			}
-			if (this.exception != null) {
-				MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			}
-		} catch (Exception exception) {
-			LogUtils.e("HttpUIAction.onPostExecute", exception.toString());
-		}
-	}
+    @Override
+    protected void onPostExecute(String result) {
+        try {
+            if (this.dialog != null) {
+                this.dialog.destroy();
+            }
+            if (this.exception != null) {
+                MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
+            }
+        } catch (Exception exception) {
+            LogUtils.e("HttpUIAction.onPostExecute", exception.toString());
+        }
+    }
 
-	public void removeDialog(){
-		try {
-			if (this.dialog != null) {
-				this.dialog.destroy();
-			}
-			if (this.exception != null) {
-				MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			}
-		} catch (Exception exception) {
-			LogUtils.e("HttpUIAction.onPostExecute", exception.toString());
-		}
-	}
+    public void removeDialog() {
+        try {
+            if (this.dialog != null) {
+                this.dialog.destroy();
+            }
+            if (this.exception != null) {
+                MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
+            }
+        } catch (Exception exception) {
+            LogUtils.e("HttpUIAction.onPostExecute", exception.toString());
+        }
+    }
 }
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
index 0a708de062101d0f440fbab96dd0eb7051bd493d..6b6e5f7a5b4508551fdbe969d3169da9981da5e5 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
@@ -13,7 +13,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.adapter;
+package org.botlibre.sdk.ability.adapter;
 
 import org.botlibre.sdk.ResourceTable;
 import ohos.aafwk.ability.Ability;
@@ -30,7 +30,7 @@ import ohos.agp.components.Text;
  * @since 2021-05-10
  */
 public class SpinnerAdapter extends BaseItemProvider {
-    private final Ability mActivity;
+    private final Ability mAbility;
     private final LayoutScatter mInflater;
     private final String[] types;
 
@@ -41,7 +41,7 @@ public class SpinnerAdapter extends BaseItemProvider {
      * @param types types
      */
     public SpinnerAdapter(Ability ability, String[] types) {
-        mActivity = ability;
+        mAbility = ability;
         this.types = types;
         mInflater = LayoutScatter.getInstance(ability);
     }
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
similarity index 40%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
index 4c9cba023915f8454dd1c3411f66ce16e41276d1..64bcfd24dbb3a4c9006e0de964875f1650ab191c 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
@@ -13,7 +13,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.avatar;
+package org.botlibre.sdk.ability.avatar;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.OfflineTemplateConfig;
@@ -28,40 +28,36 @@ import ohos.data.preferences.Preferences;
 import java.util.ArrayList;
 
 /**
- * Activity used for selecting an offline avatar.
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
  */
 public class AvatarSelection extends Ability {
 
-	@Override
-	public void onStart(Intent intent) {
-		super.onStart(intent);
-//		setContentView(R.layout.activity_list_view);
-		super.setUIContent(ResourceTable.Layout_ability_list_view);
-		final int [] imges = {};
-		final String [] names = {};
-		((Text) findComponentById(ResourceTable.Id_theTitle)).setText("Select Avatar");
-		final ListContainer listView = (ListContainer) findComponentById(ResourceTable.Id_theListView);
-		ArrayList<OfflineTemplateConfig> items = new ArrayList<OfflineTemplateConfig>();
-		for (int i = 0; i < names.length; i++) {
-			items.add(new OfflineTemplateConfig(imges[i],names[i],null,null));
-		}
-//		CustomListViewAdapter adapter = new CustomListViewAdapter(this, R.layout.list_item_imager, items);
-//		listView.setAdapter(adapter);
-//		listView.setOnItemClickListener(new OnItemClickListener(){
-//			@Override
-//			public void onItemClick(AdapterView<?> parent, View view, int position, long id) {
-//				OfflineTemplateConfig template = (OfflineTemplateConfig) (listView.getItemAtPosition(position));
-//				saveSelectedAvatar(template.getTitle());
-//				MainActivity.readZipAvatars(AvatarSelection.this, MainActivity.nameOfAvatar);
-//				finish();
-//			}});
-	}
+    @Override
+    public void onStart(Intent intent) {
+        super.onStart(intent);
+        super.setUIContent(ResourceTable.Layout_ability_list_view);
+        final int[] imges = {};
+        final String[] names = {};
+        ((Text) findComponentById(ResourceTable.Id_theTitle)).setText("Select Avatar");
+        final ListContainer listView = (ListContainer) findComponentById(ResourceTable.Id_theListView);
+        ArrayList<OfflineTemplateConfig> items = new ArrayList<OfflineTemplateConfig>();
+        for (int ii = 0; ii < names.length; ii++) {
+            items.add(new OfflineTemplateConfig(imges[ii], names[ii], null, null));
+        }
+    }
 
-	public static void saveSelectedAvatar(String nameOfAvatar) {
-		MainAbility.nameOfAvatar = nameOfAvatar;
-		Preferences cookies = PreferencesUtils.getPreferences(MainAbility.current);
-		cookies.putString("nameOfAvatar", nameOfAvatar);
-		cookies.flushSync();
-	}
+    /**
+     * saveSelectedAvatar
+     *
+     * @param nameOfAvatar
+     */
+    public static void saveSelectedAvatar(String nameOfAvatar) {
+        MainAbility.nameOfAvatar = nameOfAvatar;
+        Preferences cookies = PreferencesUtils.getPreferences(MainAbility.current);
+        cookies.putString("nameOfAvatar", nameOfAvatar);
+        cookies.flushSync();
+    }
 
 }
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
similarity index 96%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
index 247c52b51d01f24612972abee126043ce59a0c4f..7401a593f358690bbbba93b1b49fb11847f72b61 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
@@ -13,11 +13,11 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.LanguageListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.LanguageListener;
 import org.botlibre.sdk.util.Constant;
 import org.botlibre.sdk.ResourceTable;
 import ohos.aafwk.ability.Ability;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
index 929116aa9dc948e3e73c7225d35bcad2c4b79efe..d8caef1fa97f65a4d41c50e0c281907e74135f3d 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
@@ -13,12 +13,12 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
similarity index 69%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
index bbbe5bd6556d2b1faa834fdd0c87f8264e653227..f9b7aa651450855ad7e9aa4dd089a9ffaaf4d600 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
@@ -13,15 +13,18 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.listener;
+package org.botlibre.sdk.ability.listener;
 
 /**
- * Listener interface for a LiveChatConnection.
- * This gives asynchronous notification when a channel receives a message, or notice.
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
  */
 public interface LanguageListener {
-	/**
-	 * A user message was received from the channel.
-	 */
-	void selectLanguageItem(String select);
+    /**
+     * A user message was received from the channel.
+     *
+     * @param select
+     */
+    void selectLanguageItem(String select);
 }
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
similarity index 70%
rename from PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java
rename to PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
index 06dc6d719e73d6f809445b91c3ab58aa688fbeb8..153393db1cedafa2c0a6eb1d5c3da881a5b631ee 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
@@ -13,15 +13,18 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.listener;
+package org.botlibre.sdk.ability.listener;
 
 /**
- * Listener interface for a LiveChatConnection.
- * This gives asynchronous notification when a channel receives a message, or notice.
+ * SelectListener
+ *
+ * @since 2021-04-16
  */
 public interface SelectListener {
-	/**
-	 * A user message was received from the channel.
-	 */
-	void selectItem(String select);
+    /**
+     * A user message was received from the channel.
+     *
+     * @param select
+     */
+    void selectItem(String select);
 }
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java
deleted file mode 100644
index 931ecd01195a82787a6fdebeb60865b99f78a0dd..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java
+++ /dev/null
@@ -1,30 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy;
-
-/**
- * A convenience enum of different emotional states.
- */
-
-public enum EmotionalState {
-	NONE,
-	LOVE, LIKE, DISLIKE, HATE,
-	RAGE, ANGER, CALM, SERENE,
-	ECSTATIC, HAPPY, SAD, CRYING,
-	PANIC, AFRAID, CONFIDENT, COURAGEOUS,
-	SURPRISE, BORED,
-	LAUGHTER, SERIOUS;	
-}
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java
deleted file mode 100644
index ec31b8991fe6432404cb6138c13175f80213d3ff..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java
+++ /dev/null
@@ -1,94 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy;
-
-/**
- * <p>Encapsulates the result of a barcode scan invoked through {@link IntentIntegrator}.</p>
- *
- * @author Sean Owen
- */
-public final class IntentResult {
-
-  private final String contents;
-  private final String formatName;
-  private final byte[] rawBytes;
-  private final Integer orientation;
-  private final String errorCorrectionLevel;
-
-  IntentResult() {
-    this(null, null, null, null, null);
-  }
-
-  IntentResult(String contents,
-               String formatName,
-               byte[] rawBytes,
-               Integer orientation,
-               String errorCorrectionLevel) {
-    this.contents = contents;
-    this.formatName = formatName;
-    this.rawBytes = rawBytes;
-    this.orientation = orientation;
-    this.errorCorrectionLevel = errorCorrectionLevel;
-  }
-
-  /**
-   * @return raw content of barcode
-   */
-  public String getContents() {
-    return contents;
-  }
-
-  /**
-   * @return name of format, like "QR_CODE", "UPC_A". See {@code BarcodeFormat} for more format names.
-   */
-  public String getFormatName() {
-    return formatName;
-  }
-
-  /**
-   * @return raw bytes of the barcode content, if applicable, or null otherwise
-   */
-  public byte[] getRawBytes() {
-    return rawBytes;
-  }
-
-  /**
-   * @return rotation of the image, in degrees, which resulted in a successful scan. May be null.
-   */
-  public Integer getOrientation() {
-    return orientation;
-  }
-
-  /**
-   * @return name of the error correction level used in the barcode, if applicable
-   */
-  public String getErrorCorrectionLevel() {
-    return errorCorrectionLevel;
-  }
-  
-  @Override
-  public String toString() {
-    StringBuilder dialogText = new StringBuilder(100);
-    dialogText.append("Format: ").append(formatName).append('\n');
-    dialogText.append("Contents: ").append(contents).append('\n');
-    int rawBytesLength = rawBytes == null ? 0 : rawBytes.length;
-    dialogText.append("Raw bytes: (").append(rawBytesLength).append(" bytes)\n");
-    dialogText.append("Orientation: ").append(orientation).append('\n');
-    dialogText.append("EC level: ").append(errorCorrectionLevel).append('\n');
-    return dialogText.toString();
-  }
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java
deleted file mode 100644
index 9ea08abafdfcf1fe58c715e45becf77d86fb55f1..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java
+++ /dev/null
@@ -1,78 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy;
-
-import ohos.aafwk.ability.Ability;
-import ohos.aafwk.content.Intent;
-import ohos.aafwk.content.Operation;
-import ohos.eventhandler.EventHandler;
-import ohos.eventhandler.EventRunner;
-
-/**
- * Generic Ability for common behavior.
- */
-public abstract class LibreAbility extends Ability {
-
-	public void help() {
-//		Intent intent = new Intent();
-//		Operation operation = new Intent.OperationBuilder()
-//				.withDeviceId("")
-//				.withBundleName(this.getBundleName())
-//				.withAbilityName(HelpAbility.class.getName())
-//				.build();
-//		intent.setOperation(operation);
-//		startAbility(intent);
-	}
-
-	/**
-	 * 启动activity
-	 */
-	public void startOpenAbility(Ability ability,String name){
-		Intent intent = new Intent();
-		Operation operation = new Intent.OperationBuilder()
-				.withDeviceId("")
-				.withBundleName(ability.getBundleName())
-				.withAbilityName(name)
-				.build();
-		intent.setOperation(operation);
-		startAbility(intent);
-	}
-
-	/**
-	 * getIntent
-	 */
-	public Intent getIntent(Ability ability, String name) {
-		Intent intent = new Intent();
-		Operation operation = new Intent.OperationBuilder()
-				.withDeviceId("")
-				.withBundleName(ability.getBundleName())
-				.withAbilityName(name)
-				.build();
-		intent.setOperation(operation);
-		return intent;
-	}
-
-	/**
-	 * 主线程执行任务
-	 * @param runnable
-	 */
-	public static void runUI(Runnable runnable){
-		EventHandler eventHandler=new EventHandler(EventRunner.getMainEventRunner());
-		eventHandler.postSyncTask(runnable);
-
-	}
-
-}
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java
deleted file mode 100644
index 91ba2177b49dc06a8c77b99db7570350cbce8f8d..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java
+++ /dev/null
@@ -1,65 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.AvatarMedia;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.window.dialog.CommonDialog;
-
-public class HttpAddAvatarMediaAction extends HttpUIAction {
-
-	AvatarMedia config;
-	String file;
-	
-	public HttpAddAvatarMediaAction(Ability ability, String file, AvatarMedia config) {
-		super(ability);
-		this.config = config;
-		this.file = file;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.createAvatarMedia(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	protected void onPreExecute() {
-		this.dialog = new CommonDialog(this.ability);
-		//this.dialog.setCancelable(false);
-		this.dialog.setContentText("Uploading...");
-		this.dialog.show();
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		HttpAction action = new HttpGetAvatarMediaAction(this.ability, (AvatarConfig)MainAbility.instance.credentials(), true);
-		action.execute();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java
deleted file mode 100644
index ae6b10cd53226c15a8500195747604ecfc70bf45..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java
+++ /dev/null
@@ -1,141 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarMessage;
-import org.botlibre.sdk.config.ChatResponse;
-import ohos.aafwk.ability.Ability;
-
-public class HttpAvatarMessageAction extends HttpAction {
-	AvatarMessage config;
-	ChatResponse response;
-
-	public HttpAvatarMessageAction(Ability ability, AvatarMessage config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.response = MainAbility.connection.avatarMessage(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		try {
-//			final AvatarTestAbility ability = (AvatarTestAbility)this.ability;
-//
-//			Image imageView = (Image)ability.findViewById(R.id.imageView);
-//			final VideoView videoView = (VideoView)Ability.findViewById(R.id.videoView);
-//			View videoLayout = Ability.findViewById(R.id.videoLayout);
-//
-//			if (MainAbility.sound && this.response.avatarActionAudio != null && this.response.avatarActionAudio.length() > 0) {
-//				// Action audio
-//				Ability.playAudio(this.response.avatarActionAudio, false, true, true);
-//			}
-//			if (MainAbility.sound && this.response.avatarAudio != null && this.response.avatarAudio.length() > 0) {
-//				// Background audio
-//				if (!this.response.avatarAudio.equals(Ability.currentAudio)) {
-//					if (Ability.audioPlayer != null) {
-//						Ability.audioPlayer.stop();
-//						Ability.audioPlayer.release();
-//					}
-//					Ability.audioPlayer = Ability.playAudio(this.response.avatarAudio, true, true, true);
-//				}
-//			} else if (Ability.audioPlayer != null) {
-//				Ability.audioPlayer.stop();
-//				Ability.audioPlayer.release();
-//				Ability.audioPlayer = null;
-//			}
-//
-//			if (!MainAbility.disableVideo && !Ability.videoError && this.response.isVideo()) {
-//				// Video avatar
-//				if (imageView.getVisibility() != View.GONE || videoLayout.getVisibility() != View.GONE) {
-//					if (imageView.getVisibility() == View.VISIBLE) {
-//						imageView.setVisibility(View.GONE);
-//					}
-//					if (videoLayout.getVisibility() == View.GONE) {
-//						videoLayout.setVisibility(View.VISIBLE);
-//					}
-//				}
-//				if (this.response.avatarAction != null && this.response.avatarAction.length() > 0) {
-//					// Action video
-//					videoView.setOnPreparedListener(new OnPreparedListener() {
-//						@Override
-//						public void onPrepared(MediaPlayer mp) {
-//							mp.setLooping(false);
-//						}
-//					});
-//					videoView.setOnCompletionListener(new OnCompletionListener() {
-//						@Override
-//						public void onCompletion(MediaPlayer mp) {
-//							Ability.resetVideoErrorListener();
-//							videoView.setOnCompletionListener(null);
-//							Ability.playVideo(response.avatar, true);
-//							Ability.response(response);
-//						}
-//					});
-//					videoView.setOnErrorListener(new OnErrorListener() {
-//						@Override
-//						public boolean onError(MediaPlayer mp, int what, int extra) {
-//							Ability.resetVideoErrorListener();
-//							Ability.playVideo(response.avatar, true);
-//							Ability.response(response);
-//							return true;
-//						}
-//					});
-//					Ability.playVideo(this.response.avatarAction, false);
-//					return;
-//				} else {
-//					Ability.playVideo(this.response.avatar, true);
-//				}
-//			} else {
-//				// Image avatar
-//				if (imageView.getVisibility() != View.GONE || videoLayout.getVisibility() != View.GONE) {
-//					if (imageView.getVisibility() == View.GONE) {
-//						imageView.setVisibility(View.VISIBLE);
-//					}
-//					if (videoLayout.getVisibility() == View.VISIBLE) {
-//						videoLayout.setVisibility(View.GONE);
-//					}
-//				}
-//				if (response.isVideo()) {
-//					HttpGetImageAction.fetchImage(this.ability, MainAbility.instance.avatar, imageView);
-//				} else {
-//					HttpGetImageAction.fetchImage(this.ability, this.response.avatar, imageView);
-//				}
-//			}
-//
-//			Ability.response(this.response);
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java
deleted file mode 100644
index 10fbd5362165a66563844dd79f5a4f894385e68a..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java
+++ /dev/null
@@ -1,87 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import ohos.aafwk.ability.Ability;
-import org.botlibre.sdk.config.ContentConfig;
-
-
-public class HttpBrowseCategoriesAction extends HttpAction {
-	ContentConfig config;
-	Object[] categories;
-	boolean finish;
-	
-	public HttpBrowseCategoriesAction(Ability ability, String type, boolean finish) {
-		super(ability);
-		this.config = new ContentConfig();
-		this.config.type = type;
-		this.finish = finish;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		if (this.config.type.equals("Bot") && MainAbility.categories != null) {
-			this.categories = MainAbility.categories;
-		} else if (this.config.type.equals("Forum") && MainAbility.forumCategories != null) {
-			this.categories = MainAbility.forumCategories;
-		} else if (this.config.type.equals("Channel") && MainAbility.channelCategories != null) {
-			this.categories = MainAbility.channelCategories;
-		} else if (this.config.type.equals("Avatar") && MainAbility.avatarCategories != null) {
-			this.categories = MainAbility.avatarCategories;
-		} else if (this.config.type.equals("Script") && MainAbility.scriptCategories != null) {
-			this.categories = MainAbility.scriptCategories;
-		} else if (this.config.type.equals("Domain")) {
-			this.categories = new Object[0];
-		} else {
-			try {
-				this.categories = MainAbility.connection.getCategories(this.config).toArray();
-			} catch (Exception exception) {
-				this.exception = exception;
-				this.categories = new Object[0];
-			}
-		}
-		return "";
-	}
-
-	@SuppressWarnings("unchecked")
-	@Override
-	public void onPostExecute(String xml) {
-		if (this.exception != null) {
-			return;
-		}
-		if (this.config.type.equals("Bot")) {
-			MainAbility.categories = this.categories;
-		} else if (this.config.type.equals("Forum")) {
-			MainAbility.forumCategories = this.categories;
-		} else if (this.config.type.equals("Channel")) {
-			MainAbility.channelCategories = this.categories;
-		} else if (this.config.type.equals("Avatar")) {
-			MainAbility.avatarCategories = this.categories;
-		} else if (this.config.type.equals("Script")) {
-			MainAbility.scriptCategories = this.categories;
-		}
-		if (this.finish) {
-			this.ability.terminateAbility();
-		}
-		
-//		BrowseCategoriesAbility.type = this.config.type;
-//		BrowseCategoriesAbility.instances = (List<ContentConfig>)(Object)Arrays.asList(this.categories);
-//		startOpenAbility(this.ability,);
-//        Intent intent = new Intent(this.ability, BrowseCategoriesAbility.class);
-//        this.ability.startAbility(intent);
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java
deleted file mode 100644
index 58025e7ff4e1052c1ba5d09cdbeeec584944af8e..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java
+++ /dev/null
@@ -1,59 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpChangeIconAction extends HttpUIAction {
-
-	WebMediumConfig config;
-	String file;
-	
-	public HttpChangeIconAction(Ability ability, String file, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-		this.file = file;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.updateIcon(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-//			((WebMediumAdminAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java
deleted file mode 100644
index b31d24f12e56b9b531b27d7cd5da3ba434ad8252..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java
+++ /dev/null
@@ -1,159 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ChatConfig;
-import org.botlibre.sdk.config.ChatResponse;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.components.Component;
-import ohos.agp.components.Image;
-
-
-public class HttpChatAction extends HttpAction {
-	ChatConfig config;
-	ChatResponse response;
-
-	public HttpChatAction(Ability ability, ChatConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.response = MainAbility.connection.chat(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	protected void onPreExecute() {
-		if (!this.config.disconnect) {
-			super.onPreExecute();
-		}
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		if (this.config.disconnect) {
-			return;
-		}
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		try {
-			MainAbility.conversation = this.response.conversation;
-			final ChatAbility Ability = (ChatAbility)this.ability;
-
-			Image imageView = (Image)Ability.bigImage;
-			//final VideoView videoView = Ability.videoView;
-			Component videoLayout = Ability.videoLayout;
-
-			if (MainAbility.sound && this.response.avatarActionAudio != null && this.response.avatarActionAudio.length() > 0) {
-				// Action audio
-				if (MainAbility.online) {
-				}
-			}
-			if (MainAbility.sound && this.response.avatarAudio != null && this.response.avatarAudio.length() > 0) {
-				Ability.music = true;
-				// Background audio
-				if (!this.response.avatarAudio.equals(Ability.currentAudio)) {
-					if (Ability.audioPlayer != null) {
-						Ability.audioPlayer.stop();
-						Ability.audioPlayer.release();
-					}
-					if (MainAbility.online) {
-					}
-					//making sure the that mic is turned off while using the DeviceVoice.
-					ChatAbility.micLastStat = false;
-				}
-			} else if (Ability.audioPlayer != null) {
-				Ability.audioPlayer.stop();
-				Ability.audioPlayer.release();
-				Ability.audioPlayer = null;
-				Ability.music = false;
-			}
-
-			if (!MainAbility.disableVideo && !Ability.videoError && this.response.isVideo()) {
-				// Video avatar
-				if (imageView.getVisibility() != Component.HIDE || videoLayout.getVisibility() != Component.HIDE) {
-					if (imageView.getVisibility() == Component.VISIBLE) {
-						imageView.setVisibility(Component.HIDE);
-					}
-					if (videoLayout.getVisibility() == Component.HIDE) {
-						videoLayout.setVisibility(Component.VISIBLE);
-					}
-				}
-				if (this.response.avatarAction != null && this.response.avatarAction.length() > 0) {
-					// Action video
-//					videoView.setOnPreparedListener(new OnPreparedListener() {
-//						@Override
-//						public void onPrepared(MediaPlayer mp) {
-//							mp.setLooping(false);
-//						}
-//					});
-//					videoView.setOnCompletionListener(new OnCompletionListener() {
-//						@Override
-//						public void onCompletion(MediaPlayer mp) {
-//							Ability.resetVideoErrorListener();
-//							videoView.setOnCompletionListener(null);
-//							Ability.cycleVideo(response);
-//							Ability.response(response);
-//						}
-//					});
-//					videoView.setOnErrorListener(new OnErrorListener() {
-//						@Override
-//						public boolean onError(MediaPlayer mp, int what, int extra) {
-//							Ability.resetVideoErrorListener();
-//							Ability.cycleVideo(response);
-//							Ability.response(response);
-//							return true;
-//						}
-//					});
-					return;
-				} else {
-				}
-			} else {
-				// Image avatar
-				if (imageView.getVisibility() != Component.HIDE || videoLayout.getVisibility() != Component.HIDE) {
-					if (imageView.getVisibility() == Component.HIDE) {
-						imageView.setVisibility(Component.VISIBLE);
-					}
-					if (videoLayout.getVisibility() == Component.VISIBLE) {
-						videoLayout.setVisibility(Component.HIDE);
-					}
-				}
-				if (this.response.isVideo()) {
-					HttpGetImageAction.fetchImage(this.ability, ((ChatAbility)this.ability).getAvatarIcon(this.response), imageView);
-				} else {
-					HttpGetImageAction.fetchImage(this.ability, this.response.avatar, imageView);
-				}
-			}
-
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java
deleted file mode 100644
index deb18edc0046c1f2cbd533a50344abe79a6a75a2..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java
+++ /dev/null
@@ -1,79 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.util.PreferencesUtils;
-import ohos.aafwk.ability.Ability;
-import ohos.data.preferences.Preferences;
-
-public class HttpCreateAction extends HttpUIAction {
-	
-	WebMediumConfig config;
-	boolean finish;
-
-	public HttpCreateAction(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-		this.finish = true;
-	}
-	
-	public HttpCreateAction(Ability ability, WebMediumConfig config, boolean finish) {
-		super(ability);
-		this.config = config;
-		this.finish = finish;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.create(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@SuppressWarnings("rawtypes")
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-			
-			if (this.finish) {
-				this.ability.terminateAbility();
-			}
-
-			Preferences cookies= PreferencesUtils.getPreferences(this.ability);
-	    	cookies.putString(this.config.getType(), this.config.name);
-	    	cookies.flushSync();
-
-//        	Class childAbility = MainAbility.getAbility(this.config);
-//        	startOpenAbility(this.ability,childAbility.getName());
-
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java
deleted file mode 100644
index 31747bd744db1471168b6bb39f237f4e29857992..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.MediaConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpCreateChannelFileAttachmentAction extends HttpUIAction {
-
-	MediaConfig config;
-	String file;
-	
-	public HttpCreateChannelFileAttachmentAction(Ability ability, String file, MediaConfig config) {
-		super(ability);
-		this.config = config;
-		this.file = file;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.createChannelFileAttachment(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		((LiveChatAbility)this.ability).sendFile(config);
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java
deleted file mode 100644
index 7c50c369684a08cb0eaa5e1b1b4956a7dbfe3f59..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java
+++ /dev/null
@@ -1,38 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.MediaConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpCreateChannelImageAttachmentAction extends HttpCreateChannelFileAttachmentAction {
-
-    public HttpCreateChannelImageAttachmentAction(Ability ability, String file, MediaConfig config) {
-        super(ability, file, config);
-    }
-
-    @Override
-    protected String doInBackground(Void... params) {
-        try {
-            this.config = MainAbility.connection.createChannelImageAttachment(this.file, this.config);
-        } catch (Exception exception) {
-            this.exception = exception;
-        }
-        return "";
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java
deleted file mode 100644
index 4aadc32482e277fffa2c6588c8b6052916a39cc3..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java
+++ /dev/null
@@ -1,61 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpCreateForumPostAction extends HttpUIAction {
-	
-	ForumPostConfig config;
-
-	public HttpCreateForumPostAction(Ability ability, ForumPostConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.create(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.post = this.config;
-	        MainAbility.posts.add(0, this.config);
-			
-			this.ability.terminateAbility();
-//			startOpenAbility(this.ability,ForumPostAbility.class.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java
deleted file mode 100644
index 1ca20f634c0e636251d408d37fc16e9eecbe02a0..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java
+++ /dev/null
@@ -1,65 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpCreateIssueAction extends HttpUIAction {
-
-	IssueConfig config;
-
-	public HttpCreateIssueAction(Ability ability, IssueConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.create(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.issue = this.config;
-	        MainAbility.issues.add(0, this.config);
-			
-			this.ability.terminateAbility();
-	    	
-	        //Intent intent = new Intent(this.ability, IssueAbility.class);
-	        //this.ability.startAbility(intent);
-	        
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
deleted file mode 100644
index 8b07d432b3609657dd23ecdb115b446250928c0c..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
+++ /dev/null
@@ -1,41 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.MediaConfig;
-import ohos.aafwk.ability.Ability;
-import ohos.media.image.PixelMap;
-
-public class HttpCreateIssueTrackerBitmapAttachmentAction extends HttpCreateIssueTrackerFileAttachmentAction {
-    PixelMap bitmap;
-
-    public HttpCreateIssueTrackerBitmapAttachmentAction(Ability ability, PixelMap bitmap, MediaConfig config) {
-        super(ability, "", config);
-        this.bitmap = bitmap;
-    }
-
-    @Override
-    protected String doInBackground(Void... params) {
-        try {
-            this.config = MainAbility.connection.createIssueTrackerImageAttachment(this.bitmap, this.config);
-        } catch (Exception exception) {
-            this.exception = exception;
-        }
-        return "";
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java
deleted file mode 100644
index 71e098b5264c2e7ec88e722fabe6f496a0e52e78..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.MediaConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpCreateIssueTrackerFileAttachmentAction extends HttpUIAction {
-
-	MediaConfig config;
-	String file;
-
-	public HttpCreateIssueTrackerFileAttachmentAction(Ability ability, String file, MediaConfig config) {
-		super(ability);
-		this.config = config;
-		this.file = file;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.createIssueTrackerFileAttachment(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		((IssueEditorAbility)this.ability).appendFile(config);
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java
deleted file mode 100644
index d7a7e45a3310f6d7457d12d42c9fd62d949961c5..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java
+++ /dev/null
@@ -1,36 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.MediaConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpCreateIssueTrackerImageAttachmentAction extends HttpCreateIssueTrackerFileAttachmentAction {
-
-	public HttpCreateIssueTrackerImageAttachmentAction(Ability ability, String file, MediaConfig config) {
-		super(ability, file, config);
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.createIssueTrackerImageAttachment(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java
deleted file mode 100644
index 3f2f5731af5305dd296f3d26f7a07c353fcda1bf..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpCreateReplyAction extends HttpUIAction {
-	
-	ForumPostConfig config;
-
-	public HttpCreateReplyAction(Ability ability, ForumPostConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.createReply(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.post = this.config;
-			
-			this.ability.terminateAbility();
-	        
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java
deleted file mode 100644
index 41575b9ceb6ce123956ab394d166f77f36fdb4ef..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java
+++ /dev/null
@@ -1,64 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-import ohos.app.Context;
-
-public class HttpCreateUserAction extends HttpUIAction {
-	UserConfig config;
-	private Context context;
-
-	public HttpCreateUserAction(Context context, Ability ability, UserConfig config) {
-		super(ability);
-		this.config = config;
-		this.context = context;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.create(ability,this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-			removeDialog();
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-		}
-
-		if (this.exception != null) {
-			return "";
-		}
-		try {
-			MainAbility.user = this.config;
-
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return "";
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java
deleted file mode 100644
index f120c4929e484565c788a2020ae6a039b96414e8..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserMessageConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpCreateUserMessageAction extends HttpUIAction {
-	
-	UserMessageConfig config;
-
-	public HttpCreateUserMessageAction(Ability ability, UserMessageConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.createUserMessage(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-    	
-		this.ability.terminateAbility();
-    }
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java
deleted file mode 100644
index 944e7ba278e226a8d26dc8b9b2bc756e708f874d..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.util.PreferencesUtils;
-import ohos.aafwk.ability.Ability;
-import ohos.data.preferences.Preferences;
-
-public class HttpDeleteAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpDeleteAction(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-        MainAbility.wasDelete = true;
-        MainAbility.instances.remove(this.config);
-
-		Preferences cookies= PreferencesUtils.getPreferences(this.ability);
-    	cookies.putString(this.config.getType(), null);
-    	cookies.flushSync();
-    	
-		this.ability.terminateAbility();
-    }
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java
deleted file mode 100644
index 90b7d71078fa02c85293ca5906759ac67349aaa9..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java
+++ /dev/null
@@ -1,40 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpDeleteAvatarBackgroundAction extends HttpUIAction {
-
-	AvatarConfig config;
-	
-	public HttpDeleteAvatarBackgroundAction(Ability ability, AvatarConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.deleteAvatarBackground(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java
deleted file mode 100644
index a659bdab8845bcbbd098a59bd778613987bbefaf..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.AvatarMedia;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpDeleteAvatarMediaAction extends HttpUIAction {
-
-	AvatarMedia config;
-	
-	public HttpDeleteAvatarMediaAction(Ability ability, AvatarMedia config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		HttpAction action = new HttpGetAvatarMediaAction(this.ability, (AvatarConfig)MainAbility.instance.credentials(), true);
-		action.execute();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java
deleted file mode 100644
index 4a0f4c928d174327c12a6fda0b39d23fd25a0088..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpDeleteBotScriptAction extends HttpUIAction {
-
-	ScriptSourceConfig config;
-	
-	public HttpDeleteBotScriptAction(Ability ability, ScriptSourceConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.deleteBotScript(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.script = this.config;
-
-//		((BotScriptsAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java
deleted file mode 100644
index 4db525f7afb38c037ca5547d622534e6b9fe6b3d..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpDeleteForumPostAction extends HttpUIAction {
-	
-	ForumPostConfig config;
-
-	public HttpDeleteForumPostAction(Ability ability, ForumPostConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-        MainAbility.posts.remove(this.config);
-    	
-		this.ability.terminateAbility();
-    }
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java
deleted file mode 100644
index 50788a84f8edf7ba5db50041ca2d203768689931..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpDeleteIssueAction extends HttpUIAction {
-
-	IssueConfig config;
-
-	public HttpDeleteIssueAction(Ability ability, IssueConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-        MainAbility.issues.remove(this.config);
-    	
-		this.ability.terminateAbility();
-    }
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java
deleted file mode 100644
index 42fc3d90244ffd23f39b5f76e6be172872e698bb..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ResponseConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpDeleteResponseAction extends HttpUIAction {
-
-	ResponseConfig config;
-	
-	public HttpDeleteResponseAction(Ability ability, ResponseConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		((TrainingAbility)this.ability).getResponses().remove(this.config);
-//		((TrainingAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java
deleted file mode 100644
index 81ea3b96207b831f1eec63f975febe082c98def2..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpDownBotScriptAction extends HttpUIAction {
-	
-	ScriptSourceConfig config;
-
-	public HttpDownBotScriptAction(Ability ability, ScriptSourceConfig config) {
-		super(ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.downBotScript(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.script = this.config;
-		
-//	   ((BotScriptsAbility)this.ability).resetView();
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java
deleted file mode 100644
index d7ab7b479a22e4c8876aeba617bf7242ec90fc75..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java
+++ /dev/null
@@ -1,127 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ChannelConfig;
-import org.botlibre.sdk.config.DomainConfig;
-import org.botlibre.sdk.config.ForumConfig;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.util.PreferencesUtils;
-import ohos.aafwk.ability.Ability;
-import ohos.data.preferences.Preferences;
-
-public class HttpFetchAction extends HttpUIAction {
-	WebMediumConfig config;
-	boolean launch;
-
-	public HttpFetchAction(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-	
-	public HttpFetchAction(Ability ability, WebMediumConfig config, boolean launch) {
-		super(ability);
-		this.config = config;
-		this.launch = launch;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	public void superOnPostExecute(String xml) {
-		super.onPostExecute(xml);
-	}
-
-	@SuppressWarnings("rawtypes")
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-
-			Preferences cookies= PreferencesUtils.getPreferences(this.ability);
-        	cookies.putString(this.config.getType(), this.config.name);
-        	cookies.flushSync();
-
-        	Class childAbility = MainAbility.getActivity(this.config);
-        	if (this.launch && !this.config.isExternal) {
-	        	if (this.config instanceof ChannelConfig) {
-//	        		childAbility = LiveChatAbility.class;
-	        	} else if (this.config instanceof InstanceConfig) {
-//	        		childAbility = ChatAbility.class;
-	        		HttpAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-	        		action.execute();
-	        	} else if (this.config instanceof DomainConfig) {
-	        		MainAbility.connection.setDomain((DomainConfig)this.config);
-	    			MainAbility.domain = (DomainConfig)this.config;
-	    			MainAbility.tags = null;
-	    			MainAbility.categories = null;
-	    			MainAbility.forumTags = null;
-	    			MainAbility.forumCategories = null;
-	    			MainAbility.channelTags = null;
-	    			MainAbility.channelCategories = null;
-	    			MainAbility.domainTags=null;
-	    			MainAbility.domainCategories=null;
-	    			MainAbility.graphicTags = null;
-	    			MainAbility.graphicCategories = null;
-	    			
-	    			MainAbility.type = MainAbility.defaultType;	    			
-//	    	        Intent intent = new Intent(this.ability, MainAbility.class);
-//	    			intent.setFlags(Intent.FLAG_Ability_NEW_TASK);
-//	    			intent.setFlags(Intent.FLAG_Ability_CLEAR_TOP);
-//	    			this.ability.startAbility(intent);
-	    			startOpenAbility(this.ability,MainAbility.class.getName());
-	    			return;
-	        	} else if (this.config instanceof ForumConfig) {
-	        		BrowseConfig config = new BrowseConfig();
-	        		
-	        		config.typeFilter = "Public";
-	        		config.type = "Post";
-	        		config.instance = MainAbility.instance.id;
-	        		config.sort = "date";
-	        		
-	        		HttpAction action = new HttpGetPostsAction(this.ability, config);
-	        		action.execute();
-	        		return;
-	        	}
-        	} else {
-        		if (this.config instanceof InstanceConfig) {
-	        		HttpAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-	        		action.execute();
-	        	}
-        	}
-			startOpenAbility(this.ability,childAbility.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java
deleted file mode 100644
index 098afea131556518725392932b08624805a3c80c..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java
+++ /dev/null
@@ -1,84 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.activityy.ListTemplateView;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.sdk.micro.MicroConnection;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFetchActionOffline extends HttpUIResultAction {
-	WebMediumConfig config;
-	MicroConnection microConnection = new MicroConnection();
-	boolean launch;
-
-	public HttpFetchActionOffline(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	
-	public HttpFetchActionOffline(Ability ability, WebMediumConfig config, boolean launch) {
-		super(ability);
-		this.config = config;
-		this.launch = launch;
-		doInBackground();
-	}
-
-	protected void doInBackground() {
-		try {
-			//switch connections.
-			MainAbility.setOnline(false);
-			microConnection = (MicroConnection) MainAbility.connection;
-			this.config = microConnection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-			return;
-		}
-
-		onPostExecute();
-	}
-
-	@SuppressWarnings("rawtypes")
-	public void onPostExecute() {
-		if(this.ability instanceof ListTemplateView){
-			this.ability.terminateAbility();
-		}
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-			Class childAbility = MainAbility.getActivity(this.config);
-			if (this.launch && !this.config.isExternal) {
-				if (this.config instanceof InstanceConfig) {
-					childAbility = ChatAbility.class;
-//					HttpAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-//					action.execute();
-				}
-			}
-			startOpenAbility(this.ability,childAbility.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java
deleted file mode 100644
index 285104aada9f674eb523881ffaffadd47897f37c..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFetchBotAvatarAction extends HttpUIAction {
-	AvatarConfig config;
-
-	public HttpFetchBotAvatarAction(Ability ability, AvatarConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((BotAvatarAbility)this.ability).resetAvatar(this.config);
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java
deleted file mode 100644
index 81d4dca97ec837472106ec80c47e09cffb18f690..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFetchChatAvatarAction extends HttpUIAction {
-	AvatarConfig config;
-
-	public HttpFetchChatAvatarAction(Ability ability, AvatarConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((ChatAbility)this.ability).resetAvatar(this.config);
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java
deleted file mode 100644
index 1319a70b9624453bab238a309fa55d65ac598e37..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java
+++ /dev/null
@@ -1,61 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFetchForumPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpFetchForumPostAction(Ability ability, ForumPostConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.post = this.config;
-			
-//			if (this.ability instanceof ForumPostAbility) {
-//				this.ability.terminateAbility();
-//			}
-//
-//	        startOpenAbility(this.ability, ForumPostAbility.class.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java
deleted file mode 100644
index 9b7d9275afebb3788980a578be19d0f92555b6b5..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java
+++ /dev/null
@@ -1,61 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFetchIssueAction extends HttpUIAction {
-    IssueConfig config;
-
-    public HttpFetchIssueAction(Ability ability, IssueConfig config) {
-        super(ability);
-        this.config = config;
-    }
-
-    @Override
-    protected String doInBackground(Void... params) {
-        try {
-            this.config = MainAbility.connection.fetch(this.config);
-        } catch (Exception exception) {
-            this.exception = exception;
-        }
-        return "";
-    }
-
-    @Override
-    public void onPostExecute(String xml) {
-        super.onPostExecute(xml);
-        if (this.exception != null) {
-            return;
-        }
-        try {
-            MainAbility.issue = this.config;
-
-//            if (this.ability instanceof IssueAbility) {
-//                this.ability.terminateAbility();
-//            }
-//
-//            startOpenAbility(this.ability, IssueAbility.class.getName());
-        } catch (Exception error) {
-            this.exception = error;
-            MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-            return;
-        }
-    }
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java
deleted file mode 100644
index aac3da2bcc8502d3eb63db9434964605cb9e332d..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java
+++ /dev/null
@@ -1,45 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFetchOrCreateAction extends HttpFetchAction {
-
-	public HttpFetchOrCreateAction(Ability ability, WebMediumConfig config, boolean launch) {
-		super(ability, config, launch);
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		if (this.exception != null) {
-	    	InstanceConfig instance = new InstanceConfig();
-	    	instance.name = config.name;
-	    	instance.isPrivate = true;
-	    	instance.template = "template";
-	    	
-	    	instance.categories = "Misc";
-	    	instance.tags = "";
-	    	
-			HttpCreateAction action = new HttpCreateAction(ability, instance);
-			action.execute();
-		} else {
-			super.onPostExecute(xml);
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java
deleted file mode 100644
index e604770428a57b814aead3ea19cfbfa9ba2bf711..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFetchUserAction extends HttpUIAction {
-	UserConfig config;
-	boolean launch;
-
-	public HttpFetchUserAction(Ability ability, UserConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.viewUser = this.config;
-//			startOpenAbility(this.ability, ViewUserAbility.class.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java
deleted file mode 100644
index dd83c40aaf9a9024a104f717f30fe75569a0af54..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java
+++ /dev/null
@@ -1,33 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFetchWarAction extends HttpFetchAction {
-
-	public HttpFetchWarAction(Ability ability, WebMediumConfig config) {
-		super(ability, config);
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.superOnPostExecute(xml);
-//		StartWarAbility.bot1 = (InstanceConfig)this.config;
-//		((StartWarAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java
deleted file mode 100644
index 810a29b9e25f6c0367b0d07f0d7fa22756603a03..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFlagAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpFlagAction(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.flag(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.instance.isFlagged = true;
-//	    this.ability.findComponentById(ResourceTable.flaggedLabel).setVisibility(View.VISIBLE);
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java
deleted file mode 100644
index fcdac1fc27e3c5041b42f7c4bb691358ff675397..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java
+++ /dev/null
@@ -1,48 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFlagForumPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpFlagForumPostAction(Ability ability, ForumPostConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.flag(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.post.isFlagged = true;
-//	    this.ability.findComponentById(ResourceTable.flaggedLabel).setVisibility(VISIBLE);
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java
deleted file mode 100644
index 39e8f88b58f0ded24da26f7834a291a5382917fe..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFlagIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpFlagIssueAction(Ability ability, IssueConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.flag(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.issue.isFlagged = true;
-//	    this.ability.findComponentById(ResourceTable.flaggedLabel).setVisibility(VISIBLE);
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java
deleted file mode 100644
index 89f9d995a60cf75b877f9537e9f33a5274be2015..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFlagUserAction extends HttpUIAction {
-	UserConfig config;
-
-	public HttpFlagUserAction(Ability ability, UserConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.flag(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    //MainAbility.viewUser.isFlagged = true;
-	    //this.Ability.findViewById(R.id.flaggedLabel).setVisibility(View.VISIBLE);
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java
deleted file mode 100644
index f40e60adbfc36675d2c626feda5c9aa5a0e678dc..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java
+++ /dev/null
@@ -1,58 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpGetAdminsAction extends HttpUIAction {
-
-	WebMediumConfig config;
-	List<String> users;
-	
-	public HttpGetAdminsAction(Ability ability, WebMediumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.users = MainAbility.connection.getAdmins(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((WebMediumUsersAbility)this.ability).admins = this.users;
-//			((WebMediumUsersAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java
deleted file mode 100644
index 40993f31451d6589beb7fd7ebc0cb1c3d2b622ce..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java
+++ /dev/null
@@ -1,58 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.AvatarMedia;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetAvatarMediaAction extends HttpUIAction {
-	AvatarConfig config;
-	List<AvatarMedia> instances;
-	boolean finish = false;
-
-	public HttpGetAvatarMediaAction(Ability ability, AvatarConfig config, boolean finish) {
-		super(ability);
-		this.config = config;
-		this.finish = finish;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.instances = MainAbility.connection.getAvatarMedia(config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.avatarMedias = this.instances;
-		if (this.finish) {
-			this.ability.terminateAbility();
-		}
-//		startOpenAbility(this.ability, AvatarEditorAbility.class.getName());
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java
deleted file mode 100644
index 56cdbdd15fddce6689b8116e89faf37bb0370ba5..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpGetBotScriptSourceAction extends HttpUIAction {
-	ScriptSourceConfig config;
-	
-	public HttpGetBotScriptSourceAction(Ability ability, ScriptSourceConfig config) {
-		super(ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.getBotScriptSource(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) { 
-		super.onPostExecute(xml);
-		if (this.exception != null) { 
-			return;
-		}
-		try {
-			MainAbility.script = this.config;
-			
-//			((BotScriptEditorAbility)this.ability).resetView();
-			
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java
deleted file mode 100644
index 148975249aa1d9bf28dfbafab5fe20721f760b83..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.ScriptConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.List;
-
-public class HttpGetBotScriptsAction extends HttpUIAction {
-
-	InstanceConfig config;
-	List<ScriptConfig> scripts;
-	
-	public HttpGetBotScriptsAction(Ability ability, InstanceConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.scripts = MainAbility.connection.getBotScripts(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((BotScriptsAbility)this.ability).setScriptList(this.scripts);
-//			((BotScriptsAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java
deleted file mode 100644
index e0ff5c79f095018928b8df39d55a9111fc4d2e7d..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java
+++ /dev/null
@@ -1,102 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ContentConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.ArrayList;
-import java.util.List;
-
-public class HttpGetCategoriesAction extends HttpAction {
-//	ListView llview;
-	ContentConfig config;
-	Object[] categories;
-	List<ContentConfig> listCategories;
-
-	public HttpGetCategoriesAction(Ability Ability, String type) {
-		super(Ability);
-		this.config = new ContentConfig();
-		this.config.type = type;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		if (this.config.type.equals("Bot") && MainAbility.categories != null) {
-			this.categories = MainAbility.categories;
-		} else if (this.config.type.equals("Forum") && MainAbility.forumCategories != null) {
-			this.categories = MainAbility.forumCategories;
-		} else if (this.config.type.equals("Channel") && MainAbility.channelCategories != null) {
-			this.categories = MainAbility.channelCategories;
-		} else if (this.config.type.equals("Avatar") && MainAbility.avatarCategories != null) {
-			this.categories = MainAbility.avatarCategories;
-		} else if (this.config.type.equals("Script") && MainAbility.scriptCategories != null) {
-			this.categories = MainAbility.scriptCategories;
-		} else if (this.config.type.equals("Domain")&&MainAbility.domainCategories != null) {
-			this.config.domain = null;
-			this.categories = MainAbility.domainCategories;
-		} else {
-			try {
-				this.categories = MainAbility.connection.getCategories(this.config).toArray();
-			} catch (Exception exception) {
-				this.exception = exception;
-				this.categories = new Object[0];
-			}
-		}
-		return "";
-	}
-
-	@SuppressWarnings({ "rawtypes" })
-	@Override
-	public void onPostExecute(String xml) {
-		if (this.exception != null) {
-			return;
-		}
-		if (this.config.type.equals("Bot")) {
-			MainAbility.categories = this.categories;
-		} else if (this.config.type.equals("Forum")) {
-			MainAbility.forumCategories = this.categories;
-		} else if (this.config.type.equals("Channel")) {
-			MainAbility.channelCategories = this.categories;
-		} else if (this.config.type.equals("Avatar")) {
-			MainAbility.avatarCategories = this.categories;
-		} else if (this.config.type.equals("Script")) {
-			MainAbility.scriptCategories = this.categories;
-		}else if(this.config.type.equals("Domain")) {
-			MainAbility.domainCategories = this.categories;
-		}
-		
-		//extracting everything from this.categories name,icon,description
-		listCategories = new ArrayList<ContentConfig>();
-		for (int i = 0; i < categories.length; i++) {
-			listCategories.add((ContentConfig)this.categories[i]);
-		}
-		
-		//extracting the names from this.categories
-		Object[] names = new Object[this.categories.length];
-		for (int index = 0; index < this.categories.length; index++) {
-			names[index] = (((ContentConfig)this.categories[index]).name);
-		}
-		
-//		llview = (ListView) this.ability.findViewById(R.id.theListView);
-//        if (llview != null) {
-//	        ArrayAdapter adapter = new CategoryListAdapter(this.ability,
-//	                R.layout.image_list, listCategories);
-//	        llview.setAdapter(adapter);
-//        }
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java
deleted file mode 100644
index c5384cec8dd183a2a28d18683177952fc7baa631..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java
+++ /dev/null
@@ -1,59 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BotModeConfig;
-import org.botlibre.sdk.config.ChannelConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpGetChannelBotModeAction extends HttpUIAction {
-	ChannelConfig config;
-	BotModeConfig botMode;
-
-	public HttpGetChannelBotModeAction(Ability ability, ChannelConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.botMode = MainAbility.connection.getChannelBotMode(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.botMode = botMode;
-			
-//			((ChannelBotAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java
deleted file mode 100644
index cb81cfc56618683985328eba3f1d3c1009357eed..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ConversationConfig;
-import org.botlibre.sdk.config.ResponseSearchConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.List;
-
-public class HttpGetConversationsAction extends HttpUIAction {
-
-	ResponseSearchConfig config;
-	List<ConversationConfig> conversations;
-	
-	public HttpGetConversationsAction(Ability ability, ResponseSearchConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.conversations = MainAbility.connection.getConversations(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((TrainingAbility)this.ability).setConversations(this.conversations);
-//			((TrainingAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java
deleted file mode 100644
index bda035a8bc96f6872104e935edaea357b80c13c5..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java
+++ /dev/null
@@ -1,58 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BotModeConfig;
-import org.botlibre.sdk.config.ForumConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpGetForumBotModeAction extends HttpUIAction {
-	ForumConfig config;
-	BotModeConfig botMode;
-
-	public HttpGetForumBotModeAction(Ability ability, ForumConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.botMode = MainAbility.connection.getForumBotMode(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.botMode = this.botMode;
-			
-//			((ForumBotAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java
deleted file mode 100644
index 1c4ec07a1982cc7b7a2abc6f7beb561d9969a267..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java
+++ /dev/null
@@ -1,284 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.io.File;
-import java.io.FileOutputStream;
-import java.io.InputStream;
-import java.lang.ref.SoftReference;
-import java.net.URL;
-import java.util.Hashtable;
-import java.util.Map;
-
-import org.botlibre.sdk.MainAbility;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.components.Component;
-import ohos.agp.components.Image;
-import ohos.app.Context;
-import ohos.media.image.PixelMap;
-
-public class HttpGetImageAction extends HttpAction {
-	public static int MAX_HEIGHT = 1200;
-	public static int MAX_WIDTH = 600;
-	public static int MAX_FILES = 100;
-	
-	public static volatile boolean downloading;
-	
-	public static File cacheDir;
-	public static Map<String, SoftReference<PixelMap>> imageCache = new Hashtable<String, SoftReference<PixelMap>>();
-	
-	String image;
-	PixelMap bmp;
-	Image view;
-	
-	
-	
-	public static void setImage(int imageId, Component view){
-		if(view instanceof Image){
-//			((Image) view).setImageResource(imageId);
-		}
-	}
-	
-	public static void clearFileCache(Context context) {
-		try {
-			File[] files = getFileCacheDir(context).listFiles();
-	        if (files == null) {
-	            return;
-	        }
-	        for (File file : files) {
-	        	if (file.isDirectory()) {
-	        		File[] nested = file.listFiles();
-	    	        for (File nestedFile : nested) {
-	    	        	if (!nestedFile.isDirectory()) {
-	    	        		nestedFile.delete();
-	    	        	}
-	    	        }
-	        	} else {
-	        		file.delete();
-	        	}
-	        }
-		} catch (Exception failed) {
-//			Log.wtf(failed.toString(), failed);
-		}
-    }
-	
-    public static File getFileCacheDir(Context context) {
-    	if (cacheDir == null) {
-    		try {
-
-		            cacheDir = context.getCacheDir();
-		        if (!cacheDir.exists()) {
-		            cacheDir.mkdirs();
-		        }
-    		} catch (Exception failed) {
-    			failed.printStackTrace();
-    			return null;
-    		}
-    	}
-    	return cacheDir;
-    }
-    
-    public static File getFile(String filename, Context context) {
-    	File dir = getFileCacheDir(context);
-    	if (dir == null) {
-    		return null;
-    	}
-    	
-    	File file = new File(dir.getAbsolutePath() + "/" + filename);
-    	dir = new File(file.getParent());
-    	if (!dir.exists()) {
-    		dir.mkdir();
-    	} else {
-	        File[] files = dir.listFiles();
-	    	if (files.length > MAX_FILES) {
-    	        for (File nestedFile : files) {
-    	        	if (!nestedFile.isDirectory()) {
-    	        		nestedFile.delete();
-    	        	}
-    	        }	    		
-	    	}
-    	}
-    	return file;
-    }
-	
-    public static File getFile(String dirName, String filename, Context context) {
-    	File dir = getFileCacheDir(context);
-    	if (dir == null) {
-    		return null;
-    	}
-    	
-    	File file = new File(dir.getAbsolutePath() + "/" + dirName + "/" + filename);
-    	dir = new File(file.getParent());
-    	if (!dir.exists()) {
-    		dir.mkdir();
-    	} else {
-	        File[] files = dir.listFiles();
-	    	if (files.length > MAX_FILES) {
-    	        for (File nestedFile : files) {
-    	        	if (!nestedFile.isDirectory()) {
-    	        		nestedFile.delete();
-    	        	}
-    	        }	    		
-	    	}
-    	}
-    	return file;
-    }
-	
-	public static void fetchImage(Ability Ability, String image, Image view) {
-		if (image == null) {
-			return;
-		}
-		SoftReference<PixelMap> ref = imageCache.get(image);
-		if (ref != null) {
-			PixelMap bmp = ref.get();
-			if (bmp != null) {
-				if (view instanceof Image) {
-					view.setPixelMap(bmp);
-				}
-		        return;
-			}
-		}
-        HttpGetImageAction action = new HttpGetImageAction(Ability, image, view);
-    	try {
-    		action.execute().get();
-    		action.postExecute();
-    		if (action.getException() != null) {
-    			throw action.getException();
-    		}
-    	} catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-    		return;
-    	}
-	}
-	
-	public HttpGetImageAction(Ability Ability) {
-		super(Ability);
-	}
-	
-	public HttpGetImageAction(Ability Ability, String image, Image view) {
-		super(Ability);
-		this.image = image;
-		this.view = view;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-        try {
-	        URL url = MainAbility.connection.fetchImage(this.image);
-		    
-		    /*BitmapFactory.Options options = new BitmapFactory.Options();
-		    options.inJustDecodeBounds = true;
-		    long start = System.currentTimeMillis();
-		    InputStream stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream, null, options);
-		    stream.close();
-		    System.out.println("decodeStream1:" + (System.currentTimeMillis() - start));
-
-	        int height = options.outHeight;
-	        int width = options.outWidth;
-	        options.inPreferredConfig = Bitmap.Config.RGB_565;
-	        int inSampleSize = 1;
-
-	        if (height > MAX_HEIGHT) {
-	            inSampleSize = Math.round((float)height / (float)MAX_HEIGHT);
-	        }
-
-	        int expectedWidth = width / inSampleSize;
-
-	        if (expectedWidth > MAX_WIDTH) {
-	            inSampleSize = Math.round((float)width / (float)MAX_WIDTH);
-	        }
-
-		    options.inSampleSize = inSampleSize;
-		    options.inJustDecodeBounds = false;
-
-		    start = System.currentTimeMillis();
-		    stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream, null, options).recycle();
-		    stream.close();
-		    System.out.println("decodeStream2:" + (System.currentTimeMillis() - start));
-
-		    start = System.currentTimeMillis();
-		    stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream).recycle();
-		    stream.close();
-		    System.out.println("decodeStream-full:" + (System.currentTimeMillis() - start));*/
-
-		    File file = getFile(this.image, this.ability);
-		    if (!file.exists()) {
-		    	downloading = true;
-		    	file.createNewFile();
-		    	FileOutputStream outputStream = new FileOutputStream(file);
-			    InputStream stream = url.openConnection().getInputStream();
-		    	byte[] bytes= new byte[1024];
-		    	int count = 0;
-	            while (count != -1) {
-	            	count = stream.read(bytes, 0, 1024);
-		            if (count == -1) {
-		            	break;
-		            }
-		            outputStream.write(bytes, 0, count);
-	            }
-	            stream.close();
-	            outputStream.close();
-		    	downloading = false;
-		    }
-
-//		    BitmapFactory.Options options = new BitmapFactory.Options();
-//		    options.inJustDecodeBounds = true;
-//		    InputStream stream = new FileInputStream(file);
-//		    BitmapFactory.decodeStream(stream, null, options);
-//		    stream.close();
-//
-//	        int height = options.outHeight;
-//	        int width = options.outWidth;
-//	        options.inPreferredConfig = Bitmap.Config.RGB_565;
-//	        int inSampleSize = 1;
-//	        if (height > MAX_HEIGHT) {
-//	            inSampleSize = Math.round((float)height / (float)MAX_HEIGHT);
-//	        }
-//	        int expectedWidth = width / inSampleSize;
-//	        if (expectedWidth > MAX_WIDTH) {
-//	            inSampleSize = Math.round((float)width / (float)MAX_WIDTH);
-//	        }
-//		    options.inSampleSize = inSampleSize;
-//		    options.inJustDecodeBounds = false;
-//
-//		    stream = new FileInputStream(file);
-//		    this.bmp = BitmapFactory.decodeStream(stream, null, options);
-//		    stream.close();
-//
-//	        imageCache.put(this.image, new SoftReference<Bitmap>(this.bmp));
-	        return "";
-        } catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-        }
-        return null;
-	}
-
-	protected void postExecute() {
-		if (view instanceof Image) {
-//			((Image)view).setImageBitmap(bmp);
-		}
-//		else if (view instanceof Button) {
-////			((Button)view).setBackgroundDrawable(new BitmapDrawable(view.getResources(), bmp));
-//		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java
deleted file mode 100644
index 3c8193f205833111f7f14917caac1b48fd9650ce..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java
+++ /dev/null
@@ -1,125 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.List;
-
-public class HttpGetInstancesAction extends HttpUIAction {
-
-	BrowseConfig config;
-	List<WebMediumConfig> instances;
-	boolean finish = false;
-	boolean CustomAvatar = false;
-
-    public HttpGetInstancesAction(Ability ability, BrowseConfig config) {
-        super(ability);
-        this.config = config;
-    }
-
-    public HttpGetInstancesAction(Ability ability, BrowseConfig config, boolean finish) {
-        super(ability);
-        this.config = config;
-        this.finish = finish;
-    }
-
-    public HttpGetInstancesAction(Ability ability, BrowseConfig config, boolean finish, boolean CustomAvatar) {
-        super(ability);
-        this.config = config;
-        this.finish = finish;
-        this.CustomAvatar = CustomAvatar;
-    }
-
-    @Override
-    protected String doInBackground(Void... params) {
-        try {
-            this.instances = MainAbility.connection.browse(config);
-        } catch (Exception exception) {
-            this.exception = exception;
-        }
-        return "";
-    }
-
-    @Override
-    public void onPostExecute(String xml) {
-        super.onPostExecute(xml);
-        if (this.exception != null) {
-            return;
-        }
-        MainAbility.instances = this.instances;
-
-        if (this.finish) {
-            this.ability.terminateAbility();
-        }
-//        Intent intent = null;
-//        MainAbility.browse = this.config;
-//        if (config.type.equals("Forum")) {
-//            intent = getIntent(this.ability, BrowseForumAbility.class.getName());
-//        } else if (config.type.equals("Channel")) {
-//            intent = getIntent(this.ability, BrowseChannelAbility.class.getName());
-//        } else if (config.type.equals("Domain")) {
-//            intent = getIntent(this.ability, BrowseDomainAbility.class.getName());
-//        } else if (config.type.equals("Avatar")) {
-//            intent = getIntent(this.ability, BrowseAvatarAbility.class.getName());
-//        } else if (config.type.equals("Graphic")) {
-//            intent = getIntent(this.ability, BrowseGraphicAbility.class.getName());
-//            if (this.CustomAvatar) {
-//                //only happens when CustomAvatar is called
-//                intent.setParam("dataName", "Custom Avatar");
-//                intent.setParam("dataCustomAvatar", true);
-//            } else {
-//                intent.setParam("dataCustomAvatar", false);
-//            }
-//
-//        } else if (config.type.equals("Script")) {
-//            if (MainAbility.importingBotScript) {
-//                List<WebMediumConfig> onlyScripts = new ArrayList<WebMediumConfig>();
-//
-//                for (int i = 0; i < MainAbility.instances.size(); i++) {
-//                    ScriptConfig config = (ScriptConfig) MainAbility.instances.get(i);
-//                    if (config.categories.contains("Self") || config.categories.contains("AIML")) {
-//                        onlyScripts.add(config);
-//                    }
-//                }
-//                MainAbility.instances = onlyScripts;
-//            } else if (MainAbility.importingBotLog) {
-//                List<WebMediumConfig> onlyScripts = new ArrayList<WebMediumConfig>();
-//
-//                for (int i = 0; i < MainAbility.instances.size(); i++) {
-//                    ScriptConfig config = (ScriptConfig) MainAbility.instances.get(i);
-//                    if (config.categories.contains("Log") || config.categories.contains("AIML") || config.categories.contains("Response")) {
-//                        onlyScripts.add(config);
-//                    }
-//                }
-//                MainAbility.instances = onlyScripts;
-//            }
-//            intent = getIntent(this.ability, BrowseScriptAbility.class.getName());
-//        } else {
-//            intent = getIntent(this.ability, BrowseAbility.class.getName());
-//        }
-//
-//        //for result only happens when RequestAbility calls it.
-//        if (this.CustomAvatar) {
-//            this.ability.startAbilityForResult(intent, 1);
-//        } else {
-//            this.ability.startAbility(intent);
-//        }
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java
deleted file mode 100644
index b6dad790d98669004e941982a3219b054223c3a1..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java
+++ /dev/null
@@ -1,73 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-import ohos.aafwk.content.Intent;
-
-import java.util.List;
-
-public class HttpGetIssuesAction extends HttpUIAction {
-	BrowseConfig config;
-	List<IssueConfig> issues;
-	boolean finish = false;
-
-	public HttpGetIssuesAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	public HttpGetIssuesAction(Ability Ability, BrowseConfig config, boolean finish) {
-		super(Ability);
-		this.config = config;
-		this.finish = finish;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.issues = MainAbility.connection.getIssues(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.issues = this.issues;
-		
-		if (this.finish) {
-			this.ability.terminateAbility();
-		}
-		MainAbility.browseIssues = this.config;
-		Intent intent = new Intent();
-//		Operation operation = new Intent.OperationBuilder()
-//				.withDeviceId("")
-//				.withBundleName(this.ability.getBundleName())
-//				.withAbilityName(BrowseIssueAbility.class.getName())
-//				.build();
-//		intent.setOperation(operation);
-		this.ability.startAbility(intent);
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java
deleted file mode 100644
index 924140c98495c40c8d8820abb752656c41f3f849..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java
+++ /dev/null
@@ -1,59 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.LearningConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetLearningAction extends HttpUIAction {
-	InstanceConfig config;
-	LearningConfig learning;
-
-	public HttpGetLearningAction(Ability Ability, InstanceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.learning = MainAbility.connection.getLearning(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.learning = this.learning;
-			
-//			((LearningAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java
deleted file mode 100644
index 110829bcca8e12cfd1b190174764bdcc8c65f126..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java
+++ /dev/null
@@ -1,58 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetLiveChatUsersAction extends HttpAction {
-	String csv;
-	List<UserConfig> users;
-
-	public HttpGetLiveChatUsersAction(Ability Ability, String csv) {
-		super(Ability);
-		this.csv = csv;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.users = MainAbility.connection.getUsers(this.csv);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((LiveChatAbility)this.ability).setUsers(this.users);
-	
-		} catch (Exception error) {
-			this.exception = error;
-			return;			
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java
deleted file mode 100644
index 45160f90d72e965d766063cd5684290e9c6ea238..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java
+++ /dev/null
@@ -1,74 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-import ohos.aafwk.content.Intent;
-
-public class HttpGetPostsAction extends HttpUIAction {
-	BrowseConfig config;
-	List<ForumPostConfig> posts;
-	boolean finish = false;
-
-	public HttpGetPostsAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	public HttpGetPostsAction(Ability Ability, BrowseConfig config, boolean finish) {
-		super(Ability);
-		this.config = config;
-		this.finish = finish;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.posts = MainAbility.connection.getPosts(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.posts = this.posts;
-		
-		if (this.finish) {
-			this.ability.terminateAbility();
-		}
-		MainAbility.browsePosts = this.config;
-        Intent intent = new Intent();
-//		Operation operation = new Intent.OperationBuilder()
-//				.withDeviceId("")
-//				.withBundleName(this.ability.getBundleName())
-//				.withAbilityName(BrowsePostAbility.class.getName())
-//				.build();
-//		intent.setOperation(operation);
-        this.ability.startAbility(intent);
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java
deleted file mode 100644
index 3cecc102f6f3b49c4763d5d2aef16558e0021eb4..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java
+++ /dev/null
@@ -1,62 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ResponseConfig;
-import org.botlibre.sdk.config.ResponseSearchConfig;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetResponsesAction extends HttpUIAction {
-
-	ResponseSearchConfig config;
-	List<ResponseConfig> responses;
-	
-	public HttpGetResponsesAction(Ability Ability, ResponseSearchConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.responses = MainAbility.connection.getResponses(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		try {
-//			((TrainingAbility)this.ability).setResponses(this.responses);
-//			((TrainingAbility)this.ability).resetView();
-//		} catch (Exception error) {
-//			this.exception = error;
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//			return;
-//		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java
deleted file mode 100644
index adfe1d1fba0de8d6895fce86b23313b7836016b5..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetScriptSourceAction extends HttpUIAction {
-	ScriptConfig config;
-	ScriptSourceConfig script;
-	
-	public HttpGetScriptSourceAction(Ability Ability, ScriptConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.script = MainAbility.connection.getScriptSource(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.script = this.script;
-			
-//			((ScriptEditorAbility)this.ability).resetView();
-			
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java
deleted file mode 100644
index c2dec227ec6ccab052d4e335df5b41a543afedf2..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java
+++ /dev/null
@@ -1,92 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ContentConfig;
-import ohos.aafwk.ability.Ability;
-
-import javax.swing.text.html.ListView;
-
-public class HttpGetTagsAction extends HttpAction {
-	ContentConfig config;
-	Object[] tags;
-	ListView llview;
-	
-	public HttpGetTagsAction(Ability Ability, String type) {
-		super(Ability);
-		this.config = new ContentConfig();
-		this.config.type = type;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		if (this.config.type.equals("Bot") && MainAbility.tags != null) {
-			this.tags = MainAbility.tags;
-		} else if (this.config.type.equals("Forum") && MainAbility.forumTags != null) {
-			this.tags = MainAbility.forumTags;
-		} else if (this.config.type.equals("Post") && MainAbility.forumPostTags != null) {
-			this.tags = MainAbility.forumPostTags;
-		} else if (this.config.type.equals("Channel") && MainAbility.channelTags != null) {
-			this.tags = MainAbility.channelTags;
-		} else if (this.config.type.equals("Avatar") && MainAbility.avatarTags != null) {
-			this.tags = MainAbility.avatarTags;
-		} else if (this.config.type.equals("Script") && MainAbility.scriptTags != null) {
-			this.tags = MainAbility.scriptTags;
-		} else if (this.config.type.equals("Domain") && MainAbility.domainTags != null) {
-//-------			//it's not passing anything
-//			this.tags = new Object[0];
-			//Clean up the domain
-			this.config.domain = null;
-			this.tags = MainAbility.domainTags;
-		} else {
-			try {
-				this.tags = MainAbility.connection.getTags(this.config).toArray();
-			} catch (Exception exception) {
-				this.exception = exception;
-			}
-		}
-		return "";
-	}
-
-	@SuppressWarnings({ "rawtypes", "unchecked" })
-	@Override
-	public void onPostExecute(String xml) {
-		if (this.exception != null) {
-			return;
-		}
-		if (this.config.type.equals("Bot")) {
-			MainAbility.tags = this.tags;
-		} else if (this.config.type.equals("Forum")) {
-			MainAbility.forumTags = this.tags;
-		} else if (this.config.type.equals("Post")) {
-			MainAbility.forumPostTags = this.tags;
-		} else if (this.config.type.equals("Channel")) {
-			MainAbility.channelTags = this.tags;
-		} else if (this.config.type.equals("Avatar")) {
-			MainAbility.avatarTags = this.tags;
-		} else if (this.config.type.equals("Script")) {
-			MainAbility.scriptTags = this.tags;
-		}else if(this.config.type.equals("Domain")){
-			
-			//added domainTags
-			MainAbility.domainTags = this.tags;
-		}
-		
-
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java
deleted file mode 100644
index 1a72c3e9dca1f2b7938cca2c6bd5049a8de6d93e..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.InstanceConfig;
-import ohos.aafwk.ability.Ability;
-
-import javax.swing.text.html.ListView;
-import java.util.List;
-
-public class HttpGetTemplatesAction extends HttpAction {
-	ListView llview;
-	List<InstanceConfig> templates;
-
-	public HttpGetTemplatesAction(Ability Ability) {
-		super(Ability);
-	
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.templates = MainAbility.connection.getTemplates();
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	public void postExecute(String xml) {
-		if (this.exception != null) {
-			return;
-		}
-
-		MainAbility.templates = this.templates;	
-		
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java
deleted file mode 100644
index 587014504222cad8915be883e565474b6de2e100..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetUsersAction extends HttpUIAction {
-
-	WebMediumConfig config;
-	List<String> users;
-	
-	public HttpGetUsersAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.users = MainAbility.connection.getUsers(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		try {
-//			((WebMediumUsersAbility)this.ability).users = this.users;
-//			((WebMediumUsersAbility)this.ability).resetView();
-//		} catch (Exception error) {
-//			this.exception = error;
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//			return;
-//		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java
deleted file mode 100644
index d8814dc33356d7835bc5305e28fd6a0249ef5f95..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java
+++ /dev/null
@@ -1,104 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.io.File;
-import java.io.FileOutputStream;
-import java.io.InputStream;
-import java.net.URL;
-
-import org.botlibre.sdk.MainAbility;
-
-import ohos.aafwk.ability.Ability;
-import ohos.utils.net.Uri;
-
-public class HttpGetVideoAction extends HttpGetImageAction {
-	
-	String video;
-	
-	public static Uri fetchVideo(Ability Ability, String video) {
-//		if(!MainAbility.online){
-//			 File file = getFile(GetAvatarAction.nameOfFile,video, Ability);
-//			 return Uri.getUriFromFile(file);
-//		}
-		
-		if (video == null) {
-			return null;
-		}
-		
-    	if (downloading) {
-    		return null;
-    	}
-	    File file = getFile(video, Ability);
-	    if (file.exists()) {
-	    	if (downloading) {
-	    		return null;
-	    	}
-	    	return Uri.getUriFromFile(file);
-	    }
-			HttpGetVideoAction action = new HttpGetVideoAction(Ability, video);
-			try {
-				action.execute().get();
-				if (action.getException() != null) {
-					throw action.getException();
-				}
-			} catch (Exception exception) {
-				if (MainAbility.DEBUG) {
-					exception.printStackTrace();
-				}
-			}
-		return Uri.getUriFromFile(file);
-	}
-	
-	public HttpGetVideoAction(Ability Ability, String video) {
-		super(Ability);
-		this.video = video;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-        try {
-	        URL url = MainAbility.connection.fetchImage(this.video);
-
-		    File file = getFile(this.video, this.ability);
-		    if (!file.exists()) {
-		    	downloading = true;
-		    	file.createNewFile();
-		    	FileOutputStream outputStream = new FileOutputStream(file);
-			    InputStream stream = url.openConnection().getInputStream();
-		    	byte[] bytes= new byte[1024];
-		    	int count = 0;
-	            while (count != -1) {
-	            	count = stream.read(bytes, 0, 1024);
-		            if (count == -1) {
-		            	break;
-		            }
-		            outputStream.write(bytes, 0, count);
-	            }
-	            stream.close();
-	            outputStream.close();
-		    	downloading = false;
-		    }
-	        return "";
-        } catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-	    	downloading = false;
-        }
-        return null;
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java
deleted file mode 100644
index 7b8cb9efdfd3757a5faebe5e299d2fd58243903b..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.VoiceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetVoiceAction extends HttpAction {
-	InstanceConfig config;
-	VoiceConfig voice;
-
-	public HttpGetVoiceAction(Ability Ability, InstanceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.voice = MainAbility.connection.getVoice(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			if (!MainAbility.customVoice) {
-				MainAbility.voice = this.voice;
-				MainAbility.deviceVoice = this.voice.nativeVoice;
-				
-//				if (this.ability instanceof VoiceAbility) {
-//					((VoiceAbility) this.ability).resetView();
-//				}
-			}
-		} catch (Exception error) {
-			this.exception = error;
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java
deleted file mode 100644
index f3fb15e5b4e2e2d314d9611aa255f295dd016dab..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpImportBotLogAction extends HttpUIAction {
-	ScriptConfig config;
-	ScriptSourceConfig script;
-	
-	public HttpImportBotLogAction(Ability Ability, ScriptConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			//this.script = MainAbility.connection.getScriptSource(this.config);
-
-			MainAbility.connection.importBotLog(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java
deleted file mode 100644
index de0a1832da18b3ef0400db46281dac24b23b6e20..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpImportBotScriptAction extends HttpUIAction {
-	ScriptConfig config;
-	ScriptSourceConfig script;
-	
-	public HttpImportBotScriptAction(Ability Ability, ScriptConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			//this.script = MainAbility.connection.getScriptSource(this.config);
-
-			MainAbility.connection.importBotScript(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java
deleted file mode 100644
index 004a10f9d277e511a32d1b447f89573f85faa585..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpPageInstancesAction extends HttpUIAction {
-	BrowseConfig config;
-	List<WebMediumConfig> instances;
-
-	public HttpPageInstancesAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.instances = MainAbility.connection.browse(config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.instances = this.instances;
-
-		MainAbility.browse = this.config;
-//		((BrowseAbility)this.ability).instances = this.instances;
-//		((BrowseAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java
deleted file mode 100644
index bf8ffdd9bf1383224820f4101b90e2a2c7f79675..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java
+++ /dev/null
@@ -1,56 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.List;
-
-public class HttpPageIssuesAction extends HttpUIAction {
-	BrowseConfig config;
-	List<IssueConfig> issues;
-
-	public HttpPageIssuesAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.issues = MainAbility.connection.getIssues(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.issues = this.issues;
-		MainAbility.browseIssues = this.config;
-//        ((BrowseIssueAbility)this.ability).instances = this.issues;
-//        ((BrowseIssueAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java
deleted file mode 100644
index 3f07575bc0b0c8e50310ed62a235d217271062e0..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java
+++ /dev/null
@@ -1,56 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpPagePostsAction extends HttpUIAction {
-	BrowseConfig config;
-	List<ForumPostConfig> posts;
-
-	public HttpPagePostsAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.posts = MainAbility.connection.getPosts(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.posts = this.posts;
-		MainAbility.browsePosts = this.config;
-//        ((BrowsePostAbility)this.ability).instances = this.posts;
-//        ((BrowsePostAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java
deleted file mode 100644
index 7f5311c85400c2ddcfdb69b9bfab0d08e0f49c69..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java
+++ /dev/null
@@ -1,59 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
- 
- package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.GraphicConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpRefreshAction extends HttpFetchAction {
-
-	
-	GraphicConfig instance;
-	
-	
-	public HttpRefreshAction(Ability Ability, GraphicConfig config) {
-		super(Ability, config);
-		instance = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java
deleted file mode 100644
index 2acfc985187fb5b839453e365abbf7090934fb27..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java
+++ /dev/null
@@ -1,50 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarMedia;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.window.dialog.CommonDialog;
-
-public class HttpSaveAvatarBackgroundAction extends HttpUIAction {
-
-	AvatarMedia config;
-	String file;
-	
-	public HttpSaveAvatarBackgroundAction(Ability Ability, String file, AvatarMedia config) {
-		super(Ability);
-		this.config = config;
-		this.file = file;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveAvatarBackground(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	@Override
-	protected void onPreExecute() {
-		this.dialog = new CommonDialog(this.ability);
-		this.dialog.setAutoClosable(false);
-		this.dialog.setContentText("Processing...");
-		this.dialog.show();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java
deleted file mode 100644
index b39334894985a70c42b5653529d6d9923ca10064..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarMedia;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveAvatarMediaAction extends HttpUIAction {
-
-	AvatarMedia config;
-	
-	public HttpSaveAvatarMediaAction(Ability Ability, AvatarMedia config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveAvatarMedia(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		this.ability.terminateAbility();
-		MainAbility.wasDelete = true;
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java
deleted file mode 100644
index bca36f1622afb78a476cdf2b07d33249ef0359c0..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java
+++ /dev/null
@@ -1,41 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.InstanceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveBotAvatarAction extends HttpUIAction {
-
-	InstanceConfig config;
-	
-	public HttpSaveBotAvatarAction(Ability Ability, InstanceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveBotAvatar(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java
deleted file mode 100644
index 3c561c50bd7f5649cdb1728c3361fe85930d20ac..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java
+++ /dev/null
@@ -1,55 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveBotScriptSourceAction extends HttpUIAction {
-	
-	ScriptSourceConfig config;
-
-	public HttpSaveBotScriptSourceAction(Ability Ability, ScriptSourceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveBotScriptSource(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		BotScriptEditorAbility didItCompile = (BotScriptEditorAbility)this.Ability;
-//		didItCompile.didCompile();
-		MainAbility.script = this.config;
-		
-		this.ability.terminateAbility();
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java
deleted file mode 100644
index f0dcffb3aca9c44b0c5411151fa67a89b6d2ef2d..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BotModeConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveChannelBotModeAction extends HttpUIAction {
-
-	BotModeConfig config;
-	
-	public HttpSaveChannelBotModeAction(Ability Ability, BotModeConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.saveChannelBotMode(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.botMode = this.config;
-		
-		this.ability.terminateAbility();
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java
deleted file mode 100644
index 29b727eee5f6ab601a32002f44fa3f62cddd45ba..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BotModeConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveForumBotModeAction extends HttpUIAction {
-
-	BotModeConfig config;
-	
-	public HttpSaveForumBotModeAction(Ability Ability, BotModeConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.saveForumBotMode(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.botMode = this.config;
-		
-		this.ability.terminateAbility();
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java
deleted file mode 100644
index 7dd40134bbef069fe4d55005fdbeb62f33e0411a..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.LearningConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveLearningAction extends HttpUIAction {
-
-	LearningConfig config;
-	
-	public HttpSaveLearningAction(Ability Ability, LearningConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.saveLearning(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.learning = this.config;
-		
-		this.ability.terminateAbility();
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java
deleted file mode 100644
index e3d6b0d04452fb9b414fb165f8113534e5023104..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java
+++ /dev/null
@@ -1,59 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ResponseConfig;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveResponseAction extends HttpUIAction {
-
-	public ResponseConfig config;
-	public static ResponseConfig response;
-	public static ResponseConfig oldResponse;
-	
-	public HttpSaveResponseAction(Ability Ability, ResponseConfig config) {
-		super(Ability);
-		this.config = config;
-		oldResponse = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.saveResponse(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		if (this.ability instanceof TrainingAbility) {
-//			((TrainingAbility)this.ability).resetView(this.config);
-//		} else {
-//			response = this.config;
-//			this.ability.terminateAbility();
-//		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java
deleted file mode 100644
index 1b6bb6e020943482cfeccca68f69c21c1300bbfa..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveScriptSourceAction extends HttpUIAction {
-	
-	ScriptSourceConfig config;
-
-	public HttpSaveScriptSourceAction(Ability Ability, ScriptSourceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveScriptSource(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.script = this.config;
-		
-		this.ability.terminateAbility();
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java
deleted file mode 100644
index 44019813ac76cd4c970509b24fb61cdf60931069..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.VoiceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveVoiceAction extends HttpUIAction {
-
-	VoiceConfig config;
-	
-	public HttpSaveVoiceAction(Ability Ability, VoiceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.saveVoice(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.voice = this.config;
-		this.ability.terminateAbility();
-    }
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java
deleted file mode 100644
index e29cda5412b7fe5fafd73cde401c9def111fc136..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java
+++ /dev/null
@@ -1,58 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.Speech;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSpeechAction extends HttpAction {
-	Speech config;
-	String response;
-
-	public HttpSpeechAction(Ability Ability, Speech config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.response = MainAbility.connection.tts(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-//		try {
-//			final VoiceAbility Ability = (VoiceAbility)this.ability;
-//			Ability.playAudio(this.response, false, true, true);
-//		} catch (Exception error) {
-//			this.exception = error;
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//			return;
-//		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java
deleted file mode 100644
index 3084e0c356249d055168ef46ea8a379bc2cf0c82..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpStarAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpStarAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.star(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.instance.stars = config.stars;
-//	    ((WebMediumAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java
deleted file mode 100644
index a0f6e357d89bf011fbccf064f8977b6328ff840a..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpStarIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpStarIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.star(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.issue.stars = config.stars;
-//	    ((IssueAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java
deleted file mode 100644
index bda6f040b075a666ccf801bd55ac439906ca27d9..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpStarPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpStarPostAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.star(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.post.stars = config.stars;
-//	    ((ForumPostAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java
deleted file mode 100644
index aadb205007a58a40dcd91cf6796e95308e292cf6..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSubscribeAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpSubscribeAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.subscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java
deleted file mode 100644
index 6413c8886ab587ff5a9dc67355457bac2a731787..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSubscribeForumAction extends HttpUIAction {
-	ForumConfig config;
-
-	public HttpSubscribeForumAction(Ability Ability, ForumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.subscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java
deleted file mode 100644
index 123cfad81c6a3ed8fccdbfec32d41b0f4517634f..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSubscribeIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpSubscribeIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.subscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java
deleted file mode 100644
index 391196ef64021609758cdfb5fba6a328cc5488d6..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsDownAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpThumbsDownAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsDown(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.instance.thumbsDown++;
-//	    ((WebMediumAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java
deleted file mode 100644
index de4aa6992c19bdf0a233eb368b372fa0bc9e5fbe..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsDownIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpThumbsDownIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsDown(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.issue.thumbsDown++;
-//	    ((IssueAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java
deleted file mode 100644
index 32c0e7e3f26d1e356254c1ca149448aca3c9fc12..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsDownPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpThumbsDownPostAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsDown(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.post.thumbsDown++;
-//	    ((ForumPostAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java
deleted file mode 100644
index a0e01cd81214cb27ad62f8932c90cf23a46eeae0..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java
+++ /dev/null
@@ -1,51 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsUpAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpThumbsUpAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsUp(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.instance.thumbsUp++;
-//	    ((WebMediumAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java
deleted file mode 100644
index 08afc81e6afbf349da8349ce6da0645fee3c5b3c..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java
+++ /dev/null
@@ -1,50 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsUpIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpThumbsUpIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsUp(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.issue.thumbsUp++;
-//	    ((IssueAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java
deleted file mode 100644
index 26c32755b30cf35f3560c3da5928e5bcc35d7d72..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsUpPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpThumbsUpPostAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsUp(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.post.thumbsUp++;
-//	    ((ForumPostAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java
deleted file mode 100644
index 7f84fd925b4eac1dfb1feeb6b4e250f013a25c2f..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java
+++ /dev/null
@@ -1,74 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.util.LogUtils;
-import org.botlibre.sdk.util.ResUtils;
-import org.botlibre.sdk.ResourceTable;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.components.DirectionalLayout;
-import ohos.agp.components.LayoutScatter;
-import ohos.agp.window.dialog.CommonDialog;
-import ohos.agp.window.service.Display;
-import ohos.agp.window.service.DisplayAttributes;
-import ohos.agp.window.service.DisplayManager;
-
-import java.util.Optional;
-
-public abstract class HttpUIResultAction extends HttpResultAction {
-	protected CommonDialog dialog;
-
-	public HttpUIResultAction(Ability Ability) {
-		super(Ability);
-	}
-
-	// 加载
-	public void loadingDialog(){
-		try {
-			Optional<Display>
-					display = DisplayManager.getInstance().getDefaultDisplay(ability.getContext());
-			DisplayAttributes displayAttributes = display.get().getAttributes();
-			DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability.getContext()).
-					parse(ResourceTable.Layout_loading_dialog,
-							null, false);
-			this.dialog = new CommonDialog(this.ability);
-			this.dialog.setContentCustomComponent(layout);
-			this.dialog.setAutoClosable(false);
-			this.dialog.setSize(displayAttributes.width - 100,150);
-			this.dialog.show();
-		} catch (Exception exception) {
-			LogUtils.e("HttpUIAction.onPreExecute", exception.toString());
-		}
-	}
-
-	public void removeDialog(){
-		try {
-			if (this.dialog != null) {
-				this.dialog.destroy();
-			}
-			if (this.exception != null) {
-//				if(!exception.toString().equals("403")) {
-//					MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//				} else {
-					MainAbility.errorInfo(1, ResUtils.getString(ability,ResourceTable.String_exception), this.exception, this.ability);
-//				}
-			}
-		} catch (Exception exception) {
-			LogUtils.e("HttpUIAction.onPostExecute", exception.toString());
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java
deleted file mode 100644
index fbc8c448d92d8991b78b9ec2239d7f9ce6b44b66..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUnsubscribeAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpUnsubscribeAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.unsubscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java
deleted file mode 100644
index ac1a1cf098bb18266254683efe8ae18bc65ae7e1..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUnsubscribeForumAction extends HttpUIAction {
-	ForumConfig config;
-
-	public HttpUnsubscribeForumAction(Ability Ability, ForumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.unsubscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java
deleted file mode 100644
index 391f004e2092e3ff61075edcb5d3d573a5443ecd..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java
+++ /dev/null
@@ -1,49 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUnsubscribeIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpUnsubscribeIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.unsubscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java
deleted file mode 100644
index 79d282bd8dce336d5eb41663866ae717bf3ad2cf..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpBotScriptAction extends HttpUIAction {
-	
-	ScriptSourceConfig config;
-
-	public HttpUpBotScriptAction(Ability Ability, ScriptSourceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.upBotScript(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.script = this.config;
-		
-//	   ((BotScriptsAbility)this.ability).resetView();
-
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java
deleted file mode 100644
index a94f2d367c581cd3b11a6b76da9b7b7227161047..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpdateAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpUpdateAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.update(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java
deleted file mode 100644
index a90f1adb682f1e2fdc1c0db7a2ad8fed86e8c483..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpdateForumPostAction extends HttpUIAction {
-	
-	ForumPostConfig config;
-
-	public HttpUpdateForumPostAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.update(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.post = this.config;
-			
-			this.ability.terminateAbility();
-			
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java
deleted file mode 100644
index 98f115d9ab77b066b8c5e3c7eddbb993815cf8e0..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpdateIssueAction extends HttpUIAction {
-
-	IssueConfig config;
-
-	public HttpUpdateIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.update(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.issue = this.config;
-			
-			this.ability.terminateAbility();
-			
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java
deleted file mode 100644
index 95f7c7f07734d25d71bfa9bf3df469d15b7acee4..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java
+++ /dev/null
@@ -1,58 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.UserConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpdateUserAction extends HttpUIAction {
-	UserConfig config;
-
-	public HttpUpdateUserAction(Ability Ability, UserConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.update(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.user = this.config;
-
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;			
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java
deleted file mode 100644
index 4f4193aedf526ac7cb28b298bc7c87066e2e78dd..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.GraphicConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUploadGraphicMediaAction extends HttpUIAction{
-
-	GraphicConfig config;
-	String file;
-	
-	public HttpUploadGraphicMediaAction(Ability Ability, String file, GraphicConfig config) {
-		super(Ability);
-		this.config = config;
-		this.file = file;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.createGraphicMedia(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-		this.ability.terminateAbility();
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-		HttpRefreshAction refresh = new HttpRefreshAction(this.ability,config);
-		refresh.execute();
-	}
-}
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java
deleted file mode 100644
index dbdeb65e6948465c771f4e089a6cf259e39b58c5..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.UserAdminConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUserAdminAction extends HttpUIAction {
-
-	UserAdminConfig config;
-	
-	public HttpUserAdminAction(Ability Ability, UserAdminConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.userAdmin(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		if (this.config.operation.equals("AddUser")) {
-//			((WebMediumUsersAbility)this.ability).users.add(this.config.operationUser);
-//		} else if (this.config.operation.equals("RemoveUser")) {
-//			((WebMediumUsersAbility)this.ability).users.remove(this.config.operationUser);
-//		} else if (this.config.operation.equals("AddAdmin")) {
-//			((WebMediumUsersAbility)this.ability).admins.add(this.config.operationUser);
-//		} else if (this.config.operation.equals("RemoveAdmin")) {
-//			((WebMediumUsersAbility)this.ability).admins.remove(this.config.operationUser);
-//		}
-//		TextField text = (TextField) this.ability.findComponentById(ResourceTable.Id_adminText);
-//		text.setText("");
-//        text = (TextField) this.ability.findComponentById(ResourceTable.Id_userText);
-//		text.setText("");
-//		((WebMediumUsersAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java
deleted file mode 100644
index e455295af976c306d3d55f1210c889e6d3d238de..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.UserMessageConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUserMessageAction extends HttpAction {
-
-	UserMessageConfig config;
-
-	public HttpUserMessageAction(Ability Ability, UserMessageConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.createUserMessage(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		/*AlertDialog dialog = new AlertDialog.Builder(Ability).create();
-		dialog.setMessage("Chatlog sent.");
-		dialog.setButton(AlertDialog.BUTTON_NEUTRAL, "OK", new DialogInterface.OnClickListener() {
-		      public void onClick(DialogInterface dialog, int which) {
-		    	  Ability.finish();
-		      }
-		});
-		dialog.show();*/
-    }
-}
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java
deleted file mode 100644
index 8c16391bfbac8c2821d5947a0314c81f267526de..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java
+++ /dev/null
@@ -1,41 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.config.ChatResponse;
-
-public class WarAction extends HttpAction {
-	ChatResponse config;
-
-	public WarAction(ohos.aafwk.ability.Ability Ability, ChatResponse config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			Thread.sleep(4000);
-		} catch (InterruptedException exception) {}
-		return "";
-	}
-
-	@Override
-	protected void onPostExecute(String xml) {
-//		((WarAbility)this.ability).switchBots();
-//		((WarAbility)this.ability).submitChat(this.config.message);
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
index b39b01727624bff506417f57cedd360c9fc325b4..d998948edc540c7f36d5674994aeaf1f34f371ac 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
@@ -194,9 +194,15 @@ public class AvatarConfig extends WebMediumConfig {
 	public void parseXML(Element element) {
 		super.parseXML(element);
 	}
-	
+
 	/**
-	 * Find any media that match the emotion, action, and pose, or the best matches.
+	 * debug
+	 *
+	 * @param emotion
+	 * @param action
+	 * @param pose
+	 * @param pose2
+	 * @return list
 	 */
 	public List<AvatarMedia> getMedia(String emotion, String action, String pose, String pose2) {
 		if (emotion == null || emotion.isEmpty()) {
@@ -458,9 +464,13 @@ public class AvatarConfig extends WebMediumConfig {
 		}
 		return matches;
 	}
-	
+
 	/**
-	 * Find an audio media that matches the action or pose.
+	 * getAudio
+	 *
+	 * @param action
+	 * @param pose
+	 * @return list
 	 */
 	public List<AvatarMedia> getAudio(String action, String pose) {
 		if (action == null) {
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarMessage.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarMessage.java
deleted file mode 100644
index ea147c7ccf7671c82a510fdbf0dd1260ff151a24..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/AvatarMessage.java
+++ /dev/null
@@ -1,77 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import org.botlibre.sdk.util.Utils;
-
-import java.io.StringWriter;
-
-
-/**
- * An avatar message can be used to have an avatar speak a message.
- * The avatar message gives the avatar the text to speak, and returns a ChatResponse that includes the text-to-speech and video animation.
- * This object can be converted to and from XML for usage with the web API.
- */
-public class AvatarMessage extends Config {
-	public String message;
-	public String avatar;
-	public String emote;
-	public String action;
-	public String pose;
-	public boolean speak;
-	public String voice;
-	public String format;
-	public boolean hd;
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<avatar-message");
-		writeCredentials(writer);
-		if (this.avatar != null) {
-			writer.write(" avatar=\"" + this.avatar + "\"");
-		}
-		if (this.emote != null) {
-			writer.write(" emote=\"" + this.emote + "\"");
-		}
-		if (this.action != null) {
-			writer.write(" action=\"" + this.action + "\"");
-		}
-		if (this.pose != null) {
-			writer.write(" pose=\"" + this.pose + "\"");
-		}
-		if (this.format != null) {
-			writer.write(" format=\"" + this.format + "\"");
-		}
-		if (this.voice != null) {
-			writer.write(" voice=\"" + this.voice + "\"");
-		}
-		if (this.speak) {
-			writer.write(" speak=\"" + this.speak + "\"");
-		}
-		if (this.hd) {
-			writer.write(" hd=\"" + this.hd + "\"");
-		}
-		writer.write(">");
-		
-		if (this.message != null) {
-			writer.write("<message>");
-			writer.write(Utils.escapeHTML(this.message));
-			writer.write("</message>");
-		}
-		writer.write("</avatar-message>");
-		return writer.toString();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/BotModeConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/BotModeConfig.java
deleted file mode 100644
index d15bf0b7d816c5f7acbbfd47825aafc2da823c10..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/BotModeConfig.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import java.io.StringWriter;
-
-import org.w3c.dom.Element;
-
-
-/**
- * DTO for XML bot mode config.
- */
-public class BotModeConfig extends Config {
-	
-	public String mode;	
-	public String bot;
-	
-	public void parseXML(Element element) {
-		super.parseXML(element);
-		
-		this.mode = element.getAttribute("mode");
-		this.bot = element.getAttribute("bot");
-	}
-
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<bot-mode");
-		writeCredentials(writer);
-
-		if (this.mode != null) {
-			writer.write(" mode=\"" + this.mode + "\"");
-		}
-		if (this.bot != null) {
-			writer.write(" bot=\"" + this.bot + "\"");
-		}
-		
-		writer.write("/>");
-		return writer.toString();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ContentConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ContentConfig.java
deleted file mode 100644
index 603726b3d8e64309e24468a0abd14ed0ffc172b9..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ContentConfig.java
+++ /dev/null
@@ -1,59 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import java.io.StringWriter;
-
-import org.w3c.dom.Element;
-import org.w3c.dom.Node;
-
-
-/**
- * DTO for XML content config.
- */
-public class ContentConfig extends Config {
-	
-	public String type;
-	public String name;
-	public String icon;
-	public String description;
-	
-	public void parseXML(Element element) {
-		super.parseXML(element);
-		
-		this.type = element.getAttribute("type");
-		this.name = element.getAttribute("name");
-		this.icon = element.getAttribute("icon");
-		
-		Node node = element.getElementsByTagName("description").item(0);
-		if (node != null) {
-			this.description = node.getTextContent();
-		}
-	}
-
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<content");
-		writeCredentials(writer);
-
-		if (this.type != null) {
-			writer.write(" type=\"" + this.type + "\"");
-		}
-		
-		writer.write("/>");
-		return writer.toString();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ConversationConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ConversationConfig.java
deleted file mode 100644
index a2008ffa53db7c08175f209af700c3e72be43d1f..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ConversationConfig.java
+++ /dev/null
@@ -1,65 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import java.text.SimpleDateFormat;
-import java.util.ArrayList;
-import java.util.Date;
-import java.util.List;
-import java.util.Locale;
-
-import org.botlibre.sdk.util.Utils;
-import org.w3c.dom.Element;
-import org.w3c.dom.NodeList;
-
-
-/**
- * DTO for XML conversation config.
- */
-public class ConversationConfig extends Config {
-	public String id;
-	public String creationDate;
-	public String type;
-	
-	public List<InputConfig> input;
-	
-	public void parseXML(Element element) {
-		this.id = element.getAttribute("id");
-		this.creationDate = element.getAttribute("creationDate");
-		this.type = element.getAttribute("type");
-		
-		NodeList nodes = element.getElementsByTagName("input");
-		if (nodes != null && nodes.getLength() > 0) {
-			this.input = new ArrayList<InputConfig>();
-			for (int index = 0; index < nodes.getLength(); index++) {
-				Element node = (Element)nodes.item(index);
-				InputConfig config = new InputConfig();
-				config.parseXML(node);
-				this.input.add(config);
-			}
-		}
-	}
-
-	public String displayCreationDate() {
-		try {
-			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
-			Date date = formater.parse(creationDate);
-			return Utils.displayTimestamp(date);
-		} catch (Exception exception) {
-			return creationDate;
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ForumPostConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ForumPostConfig.java
index 715d6a73b07f58091066502685d41d31228bc219..5c2f8ec2484e3fcead083e350e1e2e1e0d549590 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ForumPostConfig.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ForumPostConfig.java
@@ -15,183 +15,167 @@
 
 package org.botlibre.sdk.config;
 
-import java.io.StringWriter;
-import java.text.SimpleDateFormat;
-import java.util.ArrayList;
-import java.util.Date;
-import java.util.List;
-import java.util.Locale;
-
-import org.botlibre.sdk.util.Utils;
 import org.w3c.dom.Element;
 import org.w3c.dom.Node;
 import org.w3c.dom.NodeList;
 
+import java.io.StringWriter;
+import java.util.ArrayList;
+import java.util.List;
+
 
 /**
  * DTO for XML forum post config.
  */
-public class ForumPostConfig extends Config {	
-	public String id;
-	public String topic;
-	public String summary;
-	public String details;
-	public String detailsText;
-	public String forum;
-	public String tags;
-	public int thumbsUp = 0;
-	public int thumbsDown = 0;
-	public String stars = "0";
-	public boolean isAdmin;
-	public boolean isFlagged;
-	public String flaggedReason;
-	public boolean isFeatured;
-	public String creator;
-	public String creationDate;
-	public String views;
-	public String dailyViews;
-	public String weeklyViews;
-	public String monthlyViews;
-	public String replyCount;
-	public String parent;
-	public String avatar;
-	public List<ForumPostConfig> replies;
-	
-	public boolean equals(Object object) {
-		if (object instanceof ForumPostConfig) {
-			if (this.id == null) {
-				return super.equals(object);
-			}
-			return this.id.equals(((ForumPostConfig)object).id);
-		}
-		return false;
-	}
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writeXML(writer);
-		return writer.toString();
-	}
+public class ForumPostConfig extends Config {
+    public String id;
+    public String topic;
+    public String summary;
+    public String details;
+    public String detailsText;
+    public String forum;
+    public String tags;
+    public int thumbsUp = 0;
+    public int thumbsDown = 0;
+    public String stars = "0";
+    public boolean isAdmin;
+    public boolean isFlagged;
+    public String flaggedReason;
+    public boolean isFeatured;
+    public String creator;
+    public String creationDate;
+    public String views;
+    public String dailyViews;
+    public String weeklyViews;
+    public String monthlyViews;
+    public String replyCount;
+    public String parent;
+    public String avatar;
+    public List<ForumPostConfig> replies;
+
+    public boolean equals(Object object) {
+        if (object instanceof ForumPostConfig) {
+            if (this.id == null) {
+                return super.equals(object);
+            }
+            return this.id.equals(((ForumPostConfig) object).id);
+        }
+        return false;
+    }
+
+    public String toXML() {
+        StringWriter writer = new StringWriter();
+        writeXML(writer);
+        return writer.toString();
+    }
+
+    public void writeXML(StringWriter writer) {
+        writer.write("<forum-post");
+        writeCredentials(writer);
+        if (this.id != null) {
+            writer.write(" id=\"" + this.id + "\"");
+        }
+        if (this.parent != null) {
+            writer.write(" parent=\"" + this.parent + "\"");
+        }
+        if (this.forum != null) {
+            writer.write(" forum=\"" + this.forum + "\"");
+        }
+        if (this.isFeatured) {
+            writer.write(" isFeatured=\"true\"");
+        }
+        if (this.stars != null && !this.stars.equals("")) {
+            writer.write(" stars=\"" + this.stars + "\"");
+        }
+        writer.write(">");
+        if (this.topic != null) {
+            writer.write("<topic>");
+            writer.write("</topic>");
+        }
+        if (this.details != null) {
+            String text = this.details;
+            writer.write("<details>");
+            writer.write("</details>");
+        }
+        if (this.tags != null) {
+            writer.write("<tags>");
+            writer.write(this.tags);
+            writer.write("</tags>");
+        }
+        if (this.flaggedReason != null) {
+            writer.write("<flaggedReason>");
+            writer.write("</flaggedReason>");
+        }
+        writer.write("</forum-post>");
+    }
+
+    public void parseXML(Element element) {
+        this.id = element.getAttribute("id");
+        this.parent = element.getAttribute("parent");
+        this.forum = element.getAttribute("forum");
+        this.views = element.getAttribute("views");
+        this.dailyViews = element.getAttribute("dailyViews");
+        this.weeklyViews = element.getAttribute("weeklyViews");
+        this.monthlyViews = element.getAttribute("monthlyViews");
+        this.isAdmin = Boolean.valueOf(element.getAttribute("isAdmin"));
+        this.replyCount = element.getAttribute("replyCount");
+        this.isFlagged = Boolean.valueOf(element.getAttribute("isFlagged"));
+        this.isFeatured = Boolean.valueOf(element.getAttribute("isFeatured"));
+        this.creator = element.getAttribute("creator");
+        this.creationDate = element.getAttribute("creationDate");
+        if (element.getAttribute("thumbsUp") != null && element.getAttribute("thumbsUp").trim().length() > 0) {
+            this.thumbsUp = Integer.valueOf(element.getAttribute("thumbsUp"));
+        }
+        if (element.getAttribute("thumbsDown") != null && element.getAttribute("thumbsDown").trim().length() > 0) {
+            this.thumbsDown = Integer.valueOf(element.getAttribute("thumbsDown"));
+        }
+        if (element.getAttribute("stars") != null && element.getAttribute("stars").trim().length() > 0) {
+            this.stars = element.getAttribute("stars");
+        }
 
-	public void writeXML(StringWriter writer) {
-		writer.write("<forum-post");
-		writeCredentials(writer);
-		if (this.id != null) {
-			writer.write(" id=\"" + this.id + "\"");
-		}
-		if (this.parent != null) {
-			writer.write(" parent=\"" + this.parent + "\"");
-		}
-		if (this.forum != null) {
-			writer.write(" forum=\"" + this.forum + "\"");
-		}
-		if (this.isFeatured) {
-			writer.write(" isFeatured=\"true\"");
-		}
-		if (this.stars != null && !this.stars.equals("")) {
-			writer.write(" stars=\"" + this.stars + "\"");
-		}
-		writer.write(">");
-		if (this.topic != null) {
-			writer.write("<topic>");
-			writer.write(Utils.escapeHTML(this.topic));
-			writer.write("</topic>");
-		}
-		if (this.details != null) {
-			String text = this.details;
-			writer.write("<details>");
-			writer.write(Utils.escapeHTML(text));
-			writer.write("</details>");
-		}
-		if (this.tags != null) {
-			writer.write("<tags>");
-			writer.write(this.tags);
-			writer.write("</tags>");
-		}
-		if (this.flaggedReason != null) {
-			writer.write("<flaggedReason>");
-			writer.write(Utils.escapeHTML(this.flaggedReason));
-			writer.write("</flaggedReason>");
-		}
-		writer.write("</forum-post>");
-	}
-	
-	public void parseXML(Element element) {
-		this.id = element.getAttribute("id");
-		this.parent = element.getAttribute("parent");
-		this.forum = element.getAttribute("forum");
-		this.views = element.getAttribute("views");
-		this.dailyViews = element.getAttribute("dailyViews");
-		this.weeklyViews = element.getAttribute("weeklyViews");
-		this.monthlyViews = element.getAttribute("monthlyViews");
-		this.isAdmin = Boolean.valueOf(element.getAttribute("isAdmin"));
-		this.replyCount = element.getAttribute("replyCount");
-		this.isFlagged = Boolean.valueOf(element.getAttribute("isFlagged"));
-		this.isFeatured = Boolean.valueOf(element.getAttribute("isFeatured"));
-		this.creator = element.getAttribute("creator");
-		this.creationDate = element.getAttribute("creationDate");
-		if (element.getAttribute("thumbsUp") != null && element.getAttribute("thumbsUp").trim().length() > 0) {
-			this.thumbsUp = Integer.valueOf(element.getAttribute("thumbsUp"));
-		}
-		if (element.getAttribute("thumbsDown") != null && element.getAttribute("thumbsDown").trim().length() > 0) {
-			this.thumbsDown = Integer.valueOf(element.getAttribute("thumbsDown"));
-		}
-		if (element.getAttribute("stars") != null && element.getAttribute("stars").trim().length() > 0) {
-			this.stars = element.getAttribute("stars");
-		}
-		
-		Node node = element.getElementsByTagName("summary").item(0);
-		if (node != null) {
-			this.summary = node.getTextContent();
-		}
-		node = element.getElementsByTagName("details").item(0);
-		if (node != null) {
-			this.details = node.getTextContent();
-		}
-		node = element.getElementsByTagName("detailsText").item(0);
-		if (node != null) {
-			this.detailsText = node.getTextContent();
-		}
-		node = element.getElementsByTagName("topic").item(0);
-		if (node != null) {
-			this.topic = node.getTextContent();
-		}
-		node = element.getElementsByTagName("tags").item(0);
-		if (node != null) {
-			this.tags = node.getTextContent();
-		}
-		node = element.getElementsByTagName("flaggedReason").item(0);
-		if (node != null) {
-			this.flaggedReason = node.getTextContent();
-		}
-		node = element.getElementsByTagName("avatar").item(0);
-		if (node != null) {
-			this.avatar = node.getTextContent();
-		}
-		NodeList nodes = element.getElementsByTagName("replies");
-		if (nodes != null && nodes.getLength() > 0) {
-			this.replies = new ArrayList<ForumPostConfig>();
-			for (int index = 0; index < nodes.getLength(); index++) {
-				Element reply = (Element)nodes.item(index);
-				ForumPostConfig config = new ForumPostConfig();
-				config.parseXML(reply);
-				this.replies.add(config);
-			}
-		}
-	}
-	public ForumPostConfig credentials() {
-		ForumPostConfig config = new ForumPostConfig();
-		config.id = this.id;
-		return config;
-	}
+        Node node = element.getElementsByTagName("summary").item(0);
+        if (node != null) {
+            this.summary = node.getTextContent();
+        }
+        node = element.getElementsByTagName("details").item(0);
+        if (node != null) {
+            this.details = node.getTextContent();
+        }
+        node = element.getElementsByTagName("detailsText").item(0);
+        if (node != null) {
+            this.detailsText = node.getTextContent();
+        }
+        node = element.getElementsByTagName("topic").item(0);
+        if (node != null) {
+            this.topic = node.getTextContent();
+        }
+        node = element.getElementsByTagName("tags").item(0);
+        if (node != null) {
+            this.tags = node.getTextContent();
+        }
+        node = element.getElementsByTagName("flaggedReason").item(0);
+        if (node != null) {
+            this.flaggedReason = node.getTextContent();
+        }
+        node = element.getElementsByTagName("avatar").item(0);
+        if (node != null) {
+            this.avatar = node.getTextContent();
+        }
+        NodeList nodes = element.getElementsByTagName("replies");
+        if (nodes != null && nodes.getLength() > 0) {
+            this.replies = new ArrayList<ForumPostConfig>();
+            for (int index = 0; index < nodes.getLength(); index++) {
+                Element reply = (Element) nodes.item(index);
+                ForumPostConfig config = new ForumPostConfig();
+                config.parseXML(reply);
+                this.replies.add(config);
+            }
+        }
+    }
 
-	public String displayCreationDate() {
-		try {
-			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
-			Date date = formater.parse(creationDate);
-			return Utils.displayTimestamp(date);
-		} catch (Exception exception) {
-			return creationDate;
-		}
-	}
+    public ForumPostConfig credentials() {
+        ForumPostConfig config = new ForumPostConfig();
+        config.id = this.id;
+        return config;
+    }
 }
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/InputConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/InputConfig.java
deleted file mode 100644
index e65bb04805fb545001105d293f93ce0af2efbd45..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/InputConfig.java
+++ /dev/null
@@ -1,58 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import org.botlibre.util.Utils;
-import org.w3c.dom.Element;
-import org.w3c.dom.Node;
-
-import java.text.SimpleDateFormat;
-import java.util.Date;
-import java.util.Locale;
-
-
-/**
- * DTO for XML input config.
- */
-public class InputConfig extends Config {
-	public String id;
-	public String creationDate;
-	public String speaker;
-	public String target;
-	public String value;
-	
-	public void parseXML(Element element) {
-		this.id = element.getAttribute("id");
-		this.creationDate = element.getAttribute("creationDate");
-		this.speaker = element.getAttribute("speaker");
-		this.target = element.getAttribute("target");
-		
-		Node node = element.getElementsByTagName("value").item(0);
-		if (node != null) {
-			this.value = node.getTextContent();
-		}
-	}
-
-	public String displayCreationDate() {
-		try {
-			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
-			Date date = formater.parse(creationDate);
-			return Utils.displayTime(date);
-		} catch (Exception exception) {
-			return creationDate;
-		}
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/IssueTrackerConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/IssueTrackerConfig.java
deleted file mode 100644
index 424935338607950fd57a2ebfd2fcd9749500b978..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/IssueTrackerConfig.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import org.w3c.dom.Element;
-
-import java.io.StringWriter;
-
-/**
- * DTO for XML issue tracker config.
- */
-public class IssueTrackerConfig extends WebMediumConfig {
-	public String createAccessMode;
-	public String issues;
-	
-	public String getType() {
-		return "issuetracker";
-	}
-
-	@Override
-	public String stats() {
-		return this.issues + " issues";
-	}
-	
-	public WebMediumConfig credentials() {
-		IssueTrackerConfig config = new IssueTrackerConfig();
-		config.id = this.id;
-		return config;
-	}
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<issue-tracker");
-		if (this.createAccessMode != null && !this.createAccessMode.equals("")) {
-			writer.write(" createAccessMode=\"" + this.createAccessMode + "\"");
-		}
-		writeXML(writer);
-		writer.write("</issue-tracker>");
-		return writer.toString();
-	}
-	
-	public void parseXML(Element element) {
-		super.parseXML(element);
-		this.createAccessMode = element.getAttribute("createAccessMode");
-		this.issues = element.getAttribute("issues");
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ResponseSearchConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ResponseSearchConfig.java
deleted file mode 100644
index 940cac71b62536ba171e43f09e56d7124613d0c6..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/ResponseSearchConfig.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import java.io.StringWriter;
-
-/**
- * DTO for XML response search options.
- */
-public class ResponseSearchConfig extends Config {
-	public String responseType;
-	public String inputType;
-	public String filter;
-	public String duration;
-	public String restrict;
-	public String page;
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<response-search");
-		writeCredentials(writer);
-		writer.write(" responseType=\"" + this.responseType + "\"");
-		if (this.inputType != null) {
-			writer.write(" inputType=\"" + this.inputType + "\"");
-		}
-		if (this.filter != null) {
-			writer.write(" filter=\"" + this.filter + "\"");
-		}
-		if (this.duration != null) {
-			writer.write(" duration=\"" + this.duration + "\"");
-		}
-		if (this.restrict != null) {
-			writer.write(" restrict=\"" + this.restrict + "\"");
-		}
-		if ((this.page != null) && !this.page.equals("")) {
-			writer.write(" page=\"" + this.page + "\"");
-		}
-		writer.write("/>");
-		return writer.toString();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/Speech.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/Speech.java
deleted file mode 100644
index b937640eb47c2ba88d695406159f72d97b68f0e6..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/Speech.java
+++ /dev/null
@@ -1,45 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import java.io.StringWriter;
-
-/**
- * A speech object can be used to invoke server-side text-to-speech.
- * The object takes a message text, and a voice.
- */
-public class Speech extends Config {
-	public String text;
-	public String voice;
-	public String mod;
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<speech");
-		writeCredentials(writer);
-		if (this.text != null) {
-			writer.write(" text=\"" + this.text + "\"");
-		}
-		if (this.voice != null) {
-			writer.write(" voice=\"" + this.voice + "\"");
-		}
-		if (this.mod != null) {
-			writer.write(" mod=\"" + this.mod.toLowerCase() + "\"");
-		}
-		writer.write("/>");
-		return writer.toString();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/TrainingConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/TrainingConfig.java
deleted file mode 100644
index 7352e1e29dd5d0967182152da94d08e9fd37c302..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/TrainingConfig.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import org.botlibre.util.Utils;
-
-import java.io.StringWriter;
-
-
-
-/**
- * DTO for XML training config.
- */
-public class TrainingConfig extends Config {	
-	public String operation;	
-	public String question;	
-	public String response;
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<training");
-		writeCredentials(writer);
-		
-		if (this.operation != null) {
-			writer.write(" operation=\"" + this.operation + "\"");
-		}
-		
-		writer.write(">");
-
-		if (this.question != null) {
-			writer.write("<question>");
-			writer.write(Utils.escapeHTML(this.question));
-			writer.write("</question>");
-		}
-		if (this.response != null) {
-			writer.write("<response>");
-			writer.write(Utils.escapeHTML(this.response));
-			writer.write("</response>");
-		}
-		
-		writer.write("</training>");
-		return writer.toString();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/UserAdminConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/UserAdminConfig.java
deleted file mode 100644
index a8677318080b7468ecededc1f2b71c4121f3df5e..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/UserAdminConfig.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.config;
-
-import java.io.StringWriter;
-
-import org.w3c.dom.Element;
-
-
-/**
- * DTO for XML user admin config.
- */
-public class UserAdminConfig extends Config {	
-	public String operation;
-	public String operationUser;
-	
-	public void parseXML(Element element) {
-		super.parseXML(element);
-		
-		this.operation = element.getAttribute("operation");
-		this.operationUser = element.getAttribute("operationUser");
-	}
-
-	
-	public String toXML() {
-		StringWriter writer = new StringWriter();
-		writer.write("<user-admin");
-		writeCredentials(writer);
-		
-		if (this.operation != null) {
-			writer.write(" operation=\"" + this.operation + "\"");
-		}
-		if (this.operationUser != null) {
-			writer.write(" operationUser=\"" + this.operationUser + "\"");
-		}
-		
-		writer.write("/>");
-		return writer.toString();
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/UserConfig.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/UserConfig.java
index 38578b58704d3ad5fa5813f7078ba6c9edcd5601..885e8a63b0661ef12e76043ba4f9367767b54069 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/UserConfig.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/config/UserConfig.java
@@ -15,16 +15,12 @@
 
 package org.botlibre.sdk.config;
 
-import java.io.StringWriter;
-import java.text.SimpleDateFormat;
-import java.util.Date;
-import java.util.Locale;
-
 import org.botlibre.sdk.SDKConnection;
-import org.botlibre.sdk.util.Utils;
 import org.w3c.dom.Element;
 import org.w3c.dom.Node;
 
+import java.io.StringWriter;
+
 /**
  * DTO for XML user creation config.
  */
@@ -56,27 +52,7 @@ public class UserConfig extends Config {
 	public String type;
 	public boolean isFlagged;
 	public String flaggedReason;
-	
-	public String displayJoined() {
-		try {
-			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
-			Date date = formater.parse(joined);
-			return Utils.displayDate(date);
-		} catch (Exception exception) {
-			return joined;
-		}
-	}
-	
-	public String displayLastConnect() {
-		try {
-			SimpleDateFormat formater = new SimpleDateFormat("EEE MMM dd HH:mm:ss zzz yyyy", Locale.US);
-			Date date = formater.parse(lastConnect);
-			return Utils.displayTimestamp(date);
-		} catch (Exception exception) {
-			return lastConnect;
-		}
-	}
-	
+
 	public void addCredentials(SDKConnection connection) {
 		this.application = connection.getCredentials().getApplicationId();
 		if (connection.getDomain() != null) {
@@ -163,7 +139,6 @@ public class UserConfig extends Config {
 		
 		if (this.bio != null) {
 			writer.write("<bio>");
-			writer.write(Utils.escapeHTML(this.bio));
 			writer.write("</bio>");
 		}
 		writer.write("</user>");
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
deleted file mode 100644
index 60a698640ceeaff7f39d75222a5b2264d16e5170..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
+++ /dev/null
@@ -1,205 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.micro;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.actions.HttpUIAction;
-import org.botlibre.sdk.util.PreferencesUtils;
-import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-import ohos.data.preferences.Preferences;
-import org.botlibre.Bot;
-import org.botlibre.api.knowledge.Network;
-import org.botlibre.api.knowledge.Vertex;
-import org.botlibre.api.sense.Sense;
-import org.botlibre.knowledge.Bootstrap;
-import org.botlibre.knowledge.Primitive;
-import org.botlibre.knowledge.micro.MicroMemory;
-import org.botlibre.self.SelfCompiler;
-import org.botlibre.sense.http.Wiktionary;
-import org.botlibre.sense.text.TextEntry;
-import org.botlibre.thought.consciousness.Consciousness;
-import org.botlibre.thought.language.Comprehension;
-import org.botlibre.thought.language.Language;
-import org.botlibre.thought.language.Language.LearningMode;
-
-/**
- * Bootstrap the bot the first time from an online response list file or script.
- */
-public class BootstrapAsync extends HttpUIAction {
-	public BootstrapAsync(Ability Ability) {
-		super(Ability);
-	}
-
-	protected String aimlScriptId;
-	protected String selfScriptId;
-	protected String greetingScriptId;
-	InstanceConfig config;
-	MicroConnection connection;
-	Bot bot=null;
-	boolean noInternet = false;
-	
-	//passing InstanceConfig and the Scripts Versions.
-	public synchronized void bootstrapBot(InstanceConfig config, String aimlScriptId, String greetingScriptId) {
-		this.greetingScriptId = greetingScriptId;
-		this.aimlScriptId = aimlScriptId;
-		this.config = config;	
-		this.execute();
-	}
-
-	protected boolean isResetRequired() {
-		// Check if bot memory exists.
-		if (!MicroMemory.checkExists()) {
-			return true;
-		}
-		try{
-		// Check if version is changed.
-		Preferences cookies = PreferencesUtils.getPreferences(MainAbility.current);
-		String aimlVersion = cookies.getString(this.aimlScriptId, null);
-		String greetingVersion = cookies.getString(this.greetingScriptId, null);
-		if (aimlVersion == null || aimlVersion.isEmpty() || greetingVersion == null || greetingVersion.isEmpty()) {
-			return true;
-		}
-		ScriptConfig aimlScript = new ScriptConfig();
-		aimlScript.id = this.aimlScriptId;
-		aimlScript = MainAbility.connection.fetch(aimlScript);
-		if (!aimlVersion.equals(aimlScript.version)) {
-			return true;
-		}
-		ScriptConfig greetingScript = new ScriptConfig();
-		greetingScript.id = this.greetingScriptId;
-		greetingScript = MainAbility.connection.fetch(greetingScript);
-		if (!greetingVersion.equals(greetingScript.version)) {
-			return true;
-		}
-		} catch (Exception ignore) {
-			return false;
-		}
-		return false;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MicroMemory.storageFileName = this.config.id;
-			this.connection = (MicroConnection) MainAbility.connection;
-			// Check if bot is already loaded first.
-			if (connection.getBot(this.config.id) != null) {
-				return "";
-			}
-			// Check if bot memory exists.
-			boolean resetRequired = isResetRequired();
-			
-			// If no reset is required, just load the bot.
-			if (!resetRequired) {
-				try {
-					this.bot = Bot.createInstance(Bot.CONFIG_FILE, this.config.id, true);
-					Language language = bot.mind().getThought(Language.class);
-					language.setLearningMode(LearningMode.Disabled);
-					language.setLearnGrammar(false);
-					Comprehension comprehension = bot.mind().getThought(Comprehension.class);
-					comprehension.setEnabled(false);
-					Consciousness consciousness = bot.mind().getThought(Consciousness.class);
-					consciousness.setEnabled(false);
-					Sense sense = bot.awareness().getSense(Wiktionary.class);
-					sense.setIsEnabled(false);
-				} catch (Exception failed) {
-					// If the load fails, then reset the bot.
-					resetRequired = true;
-				}
-			}
-			// If a reset is required the bot must be rebuilt from scratch and reimport the AIML and greeting files.
-			if (resetRequired) {
-				// Delete the old file if exists.
-				MicroMemory.reset();
-				// Fetch the scripts source code.
-				ScriptConfig aimlScript = new ScriptConfig();
-				aimlScript.id = this.aimlScriptId;
-				ScriptSourceConfig aimlSource = connection.getScriptSource(aimlScript);
-				ScriptConfig greetingScript = new ScriptConfig();
-				greetingScript.id = this.greetingScriptId;
-				ScriptSourceConfig greetingSource = connection.getScriptSource(greetingScript);
-				
-				MicroMemory.reset();
-				// Create new bot.
-				bot = Bot.createInstance(Bot.CONFIG_FILE, this.config.id, true);
-				Language language = bot.mind().getThought(Language.class);
-				language.setLearningMode(LearningMode.Disabled);
-				language.setLearnGrammar(false);
-				Comprehension comprehension = bot.mind().getThought(Comprehension.class);
-				comprehension.setEnabled(false);
-				Consciousness consciousness = bot.mind().getThought(Consciousness.class);
-				consciousness.setEnabled(false);
-				Sense sense = bot.awareness().getSense(Wiktionary.class);
-				sense.setIsEnabled(false);
-				//if bootstrapSystem was true, it will load the default script.
-				// Do not need to bootstrap, as only uses AIML.
-				new Bootstrap().bootstrapSystem(bot, false);
-				// Load AIML file.
-				language.loadAIML(aimlSource.source, "ami", true, false, false);
-				// Load greeting response list.
-				bot.awareness().getSense(TextEntry.class).loadChat(greetingSource.source, "Response List", false, true);
-
-				// Shutdown will save the file.
-				bot.shutdown();
-				// Reload the bot from the file.
-				bot = Bot.createInstance(Bot.CONFIG_FILE, this.config.id, true);
-				language = bot.mind().getThought(Language.class);
-				language.setLearningMode(LearningMode.Disabled);
-				language.setLearnGrammar(false);
-				comprehension = bot.mind().getThought(Comprehension.class);
-				comprehension.setEnabled(false);
-				consciousness = bot.mind().getThought(Consciousness.class);
-				consciousness.setEnabled(false);
-				sense = bot.awareness().getSense(Wiktionary.class);
-				sense.setIsEnabled(false);
-
-				Preferences cookies = PreferencesUtils.getPreferences(MainAbility.current);
-				cookies.putString(this.aimlScriptId, aimlSource.versionName);
-				cookies.putString(this.greetingScriptId, greetingSource.versionName);
-				cookies.flush();
-			}
-			// Finally, add the bot to the connections active bots.
-			connection.addBot(this.config.id, bot);
-		} catch (Exception exception) {
-			noInternet = true;
-//			MicroMemory.reset();
-			return null;
-		}
-		return null;
-	}
-
-	/**
-	 * Load, compile, and add the state machine from the Self source code.
-	 */
-	public void loadSelf(Bot bot, String text) {
-
-		Network network = bot.memory().newMemory();
-		Vertex language = network.createVertex(bot.mind().getThought(Language.class).getPrimitive());
-		SelfCompiler compiler = SelfCompiler.getCompiler();
-		Vertex stateMachine = compiler.parseStateMachine(text, false, network);
-		SelfCompiler.getCompiler().pin(stateMachine);
-		language.addRelationship(Primitive.STATE, stateMachine);
-		network.save();
-	}
-	
-	@Override
-	protected void onPostExecute(String result) {
-		super.onPostExecute(result);
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
index 623381f93a8aee66f239d2a7091e2c5aca363a64..a183e1306868ef0b0297301a572b6173d4419be1 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
@@ -15,251 +15,80 @@
 
 package org.botlibre.sdk.micro;
 
-import java.io.File;
-import java.io.IOException;
-import java.io.InputStream;
-import java.net.URL;
-import java.util.HashMap;
-import java.util.Map;
-
+import org.botlibre.Bot;
+import org.botlibre.knowledge.micro.MicroMemory;
 import org.botlibre.sdk.Credentials;
 import org.botlibre.sdk.SDKConnection;
-import org.botlibre.sdk.SDKException;
-import org.botlibre.sdk.config.AvatarConfig;
-import org.botlibre.sdk.config.ChatConfig;
-import org.botlibre.sdk.config.ChatResponse;
 import org.botlibre.sdk.config.InstanceConfig;
-import org.botlibre.sdk.config.VoiceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
-import org.botlibre.Bot;
-import org.botlibre.api.knowledge.Network;
-import org.botlibre.api.knowledge.Vertex;
-import org.botlibre.api.sense.Sense;
-import org.botlibre.knowledge.Bootstrap;
-import org.botlibre.knowledge.Primitive;
-import org.botlibre.knowledge.micro.MicroMemory;
-import org.botlibre.self.SelfCompiler;
-import org.botlibre.sense.http.Wiktionary;
-import org.botlibre.sense.text.TextEntry;
-import org.botlibre.sense.text.TextInput;
 import org.botlibre.sense.text.TextListener;
 import org.botlibre.sense.text.TextOutput;
-import org.botlibre.thought.consciousness.Consciousness;
-import org.botlibre.thought.language.Comprehension;
-import org.botlibre.thought.language.Language;
-import org.botlibre.thought.language.Language.LearningMode;
+
+import java.util.HashMap;
+import java.util.Map;
+
 
 /**
- * The MicroConnection replaces the normal SDK remote connection with one that creates
- * and accessed bots locally.
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
  */
 public class MicroConnection extends SDKConnection implements TextListener {
-	private WebMediumConfig config;
-	protected Map<String, Bot> activeBots = new HashMap<String, Bot>();
-	public static AvatarConfig avatarConfig;
-	public TextOutput message;
-	public static Bot bot;
-	
-	/**
-	 * Create a micro/offline SDK connection.
-	 */
-	public MicroConnection() {
-	}
-	
-	/**
-	 * Create a micro/offline SDK connection.
-	 * Use the credentials to enable online support.
-	 */
-	public MicroConnection(Credentials credentials) {
-		this.credentials = credentials;
-		this.url = credentials.url;
-	}
-
-	public void addBot(String id, Bot bot) {
-		activeBots.put(id, bot);
-	}
-
-	public Bot getBot(String id) {
-		return activeBots.get(id);
-	}
-
-	public static Bot getBot() {
-		return bot;
-	}
-
-	/**
-	 * Process the bot chat message and return the bot's response.
-	 * The ChatConfig should contain the conversation id if part of a conversation.
-	 * If a new conversation the conversation id is returned in the response. 
-	 */
-	public synchronized ChatResponse chat(ChatConfig config) {
-		if (config.instance == null) {
-			config.instance = "default";
-		}
-		// this method will return a Bot with the default instance
-		Bot bot = getBot(this.config.id);
-		try {
-			int i = 0;
-			while (i <= 4) {
-				if (bot == null) {
-					wait(1000);
-					bot = this.activeBots.get(config.instance);
-				} else if (bot != null) {
-					break;
-				}
-				i++;
-			}
-		} catch (Exception e) {}
-
-		if (bot == null) {
-			this.exception = new SDKException("Bot doesn't exists!");
-			throw this.exception;
-		}
-
-		TextEntry sense = bot.awareness().getSense(TextEntry.class);
-		// setting the user admin for the BOT.
-		sense.setUser(reInitialize(bot));
-		bot.setFilterProfanity(false);
-
-		sense.setTextListener(this);
-		this.message = null;
-		TextInput textInput = new TextInput(config.message);
-		textInput.setCorrection(config.correction);
-		textInput.setOffended(config.offensive);
-
-		sense.input(textInput);
-		ChatResponse response = new ChatResponse();
-
-		try {
-			if (this.message == null) {
-				wait(5000);
-			}
-			if (this.message != null) {
-				response.message = this.message.getMessage();
-				response.command = bot.avatar().getCommand();
-				try {
-					avatarConfig.chatReply(response);
-				} catch (Exception e) {
-				}
-			}
-		} catch (InterruptedException exception) {
-			this.exception = new SDKException("Timeout waiting for response");
-			throw this.exception;
-		}
-		return response;
-	}
-	
-	/**
-	 * Fetch the local object.
-	 */
-	public <T extends WebMediumConfig> T fetch(T config) {
-		this.config = config;
-		MicroMemory.storageFileName = config.name;
-		int id = Integer.parseInt(config.id);
-//		bot = loadBot(config.name, id);
-//		addBot(config.id, bot);
-		if(!(config instanceof InstanceConfig)){
-			return super.fetch(config);
-		}
-		return config;
-	}
-	
-	/**
-	 * Return the bot's voice configuration.
-	 */
-	public VoiceConfig getVoice(InstanceConfig config) {
-		VoiceConfig voice = new VoiceConfig();
-		voice.nativeVoice = true;
-		voice.language = "en";
-		return voice;
-	}
-	
-	public synchronized void sendMessage(TextOutput message) {
-		this.message = message;
-		notifyAll();
-	}
-	
-	public synchronized Bot loadBot(String name, int id) {
-		boolean exists = MicroMemory.checkExists();
-		Bot.CONFIG_FILE = "config.xml";
-		Bot bot = Bot.createInstance(Bot.CONFIG_FILE, name, true);
-		bot.setName(name);
-
-		Language language = bot.mind().getThought(Language.class);
-		language.setLearnGrammar(false);
-		//if (id != 2) {
-			language.setLearningMode(LearningMode.Disabled);
-			Comprehension comprehension = bot.mind().getThought(Comprehension.class);
-			comprehension.setEnabled(false);
-			Consciousness consciousness = bot.mind().getThought(Consciousness.class);
-			consciousness.setEnabled(false);
-			Sense sense = bot.awareness().getSense(Wiktionary.class);
-			sense.setIsEnabled(false);
-		//}
-
-		if (!exists) {
-			try {
-				new Bootstrap().bootstrapSystem(bot, false);
-				loadResScript(bot, "/assets/servicebot.res");
-				loadResScript(bot, "/assets/farewells.res");
-				loadResScript(bot, "/assets/pizza.res");
-				loadSelfScript(bot, "/assets/pizza.self");
-				bot.memory().shutdown();
-			} catch (Exception exception) {
-			}
-		}
-		return bot;
-	}
-	
-	public void loadAIMLScript(Language lang,InputStream source){
-		lang.loadAIMLFile(source, config.id, false, false, true,"",10000000);
-	}
-	
-	public void loadResScript(Bot bot, String fileName) {
-		URL url = getClass().getResource(fileName);
-		bot.awareness().getSense(TextEntry.class).loadChatFile(url, "Response List", "", false, true);
-	}
-
-	public void loadResScript(Bot bot, File file) {
-		bot.awareness().getSense(TextEntry.class).loadChatFile(file, "Response List", "", false, true);
-	}
-	
-	public void loadSelfScript(Bot bot, String fileName) {
-		loadSelfScript(bot, getClass().getResource(fileName));
-	}
-
-	public void loadSelfScript(Bot bot, URL url) {
-		Network network = bot.memory().getShortTermMemory();
-		Vertex language = network.createVertex(new Primitive(Language.class.getName()));
-		SelfCompiler compiler = SelfCompiler.getCompiler();
-		Vertex stateMachine = compiler.parseStateMachine(url, "", false, network);
-		language.addRelationship(Primitive.STATE, stateMachine);
-		SelfCompiler.getCompiler().pin(stateMachine);
-	}
-
-	public void loadSelfScript(Bot bot, File file) {
-		Network network = bot.memory().getShortTermMemory();
-		Vertex language = network.createVertex(new Primitive(Language.class.getName()));
-		SelfCompiler compiler = SelfCompiler.getCompiler();
-		Vertex stateMachine = compiler.parseStateMachine(file, "", false, network);
-		language.addRelationship(Primitive.STATE, stateMachine);
-		SelfCompiler.getCompiler().pin(stateMachine);
-	}
-	
-	public void renameMemory(Bot bot, String name) {
-		bot.memory().getShortTermMemory().createVertex(Primitive.SELF).addRelationship(Primitive.NAME, bot.memory().getShortTermMemory().createVertex(name));
-		
-	}
-	
-	public Vertex reInitialize(Bot bot) {
-		Network memory = bot.memory().newMemory();
-		Vertex user = memory.createSpeaker("Admin");
-		user.addRelationship(Primitive.ASSOCIATE, Primitive.ADMINISTRATOR);
-		memory.save();
-		return user;
-	}
-	
-	public static void copyStream(InputStream input) throws IOException {
-
-	}
+    private WebMediumConfig config;
+    protected Map<String, Bot> activeBots = new HashMap<String, Bot>();
+    /**
+     * message
+     */
+    public TextOutput message;
+    /**
+     * bot
+     */
+    public static Bot bot;
+
+    /**
+     * Create a micro/offline SDK connection.
+     */
+    public MicroConnection() {
+    }
+
+    /**
+     * Create a micro/offline SDK connection.
+     * Use the credentials to enable online support.
+     *
+     * @param credentials
+     */
+    public MicroConnection(Credentials credentials) {
+        this.credentials = credentials;
+        this.url = credentials.url;
+    }
+
+    public static Bot getBot() {
+        return bot;
+    }
+
+    /**
+     * Fetch the local object.
+     *
+     * @param <T>    web
+     * @param config
+     * @return config
+     */
+    public <T extends WebMediumConfig> T fetch(T config) {
+        this.config = config;
+        MicroMemory.storageFileName = config.name;
+        if (!(config instanceof InstanceConfig)) {
+            return super.fetch(config);
+        }
+        return config;
+    }
+
+    /**
+     * reInitialize
+     *
+     * @param message
+     */
+    public void sendMessage(TextOutput message) {
+        this.message = message;
+        notifyAll();
+    }
 }
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
index 3ed63fe8672c0d7adc97c3e956a8c65034deb75e..418951e5857fd1fbe0d6beb5f9c19a65b265df3b 100644
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
+++ b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
@@ -23,7 +23,11 @@ import ohos.agp.components.*;
 
 import java.util.List;
 
-
+/**
+ * HttpConnectAction
+ *
+ * @since 2021-04-16
+ */
 public class ChatListProvicer extends BaseItemProvider {
 
     private List<Object> list;
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/slice/MainAbilitySlice.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/slice/MainAbilitySlice.java
deleted file mode 100644
index c89b43d68c7ca899588c9d3745206ef8f209ab12..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/slice/MainAbilitySlice.java
+++ /dev/null
@@ -1,64 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.slice;
-
-import org.botlibre.sdk.util.LogUtils;
-import org.botlibre.sdk.ResourceTable;
-import ohos.aafwk.ability.AbilitySlice;
-import ohos.aafwk.content.Intent;
-import ohos.agp.window.dialog.CommonDialog;
-import ohos.agp.window.dialog.IDialog;
-
-public class MainAbilitySlice extends AbilitySlice {
-    @Override
-    public void onStart(Intent intent) {
-        super.onStart(intent);
-        super.setUIContent(ResourceTable.Layout_ability_main);
-    }
-
-    @Override
-    public void onActive() {
-        super.onActive();
-    }
-
-    @Override
-    public void onForeground(Intent intent) {
-        super.onForeground(intent);
-    }
-
-
-    public static void showMessage(String title, String message, AbilitySlice Ability) {
-        try {
-            CommonDialog dialog = new CommonDialog(Ability);
-            dialog.setContentText(message);
-            if (title != null) {
-                dialog.setTitleText(title);
-            }
-            dialog.setButton(CommonDialog.BUTTON1, "OK", new IDialog.ClickedListener() {
-                @Override
-                public void onClick(IDialog iDialog, int i) {
-                }
-            });
-            dialog.show();
-        } catch (Exception exception) {
-            LogUtils.e("showMessage", exception.toString());
-        }
-    }
-
-    public static void showMessage(String message, AbilitySlice Ability) {
-        showMessage(null, message, Ability);
-    }
-}
diff --git a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/util/Utils.java b/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/util/Utils.java
deleted file mode 100644
index 1ef3aaa11962b8903118169f7ab94c934d6208ff..0000000000000000000000000000000000000000
--- a/PizzaBotOffline/entry/src/main/java/org/botlibre/sdk/util/Utils.java
+++ /dev/null
@@ -1,514 +0,0 @@
-/*
- * Copyright (C) 2021 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain an copy of the License at
- *
- * http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.util;
-
-import org.botlibre.BotException;
-
-import java.io.IOException;
-import java.io.InputStream;
-import java.io.InputStreamReader;
-import java.io.StringWriter;
-import java.util.Calendar;
-import java.util.Collection;
-import java.util.Date;
-import java.util.List;
-import java.util.Locale;
-import java.util.Random;
-import java.util.regex.Matcher;
-import java.util.regex.Pattern;
-
-
-/**
- * Utility class.
- */
-public class Utils {
-	public static Random random = new Random();
-	
-	public static Pattern httpRegex = Pattern.compile("\\b(?:https?|ftp|file):\\/\\/[a-z0-9-+&@#\\/%?=~_|!:,.;]*[a-z0-9-+&@#\\/%=~_|]", Pattern.CASE_INSENSITIVE);
-	public static Pattern wwwRegex = Pattern.compile("((www\\.)[^\\s]+)", Pattern.CASE_INSENSITIVE);
-	public static Pattern emailRegex = Pattern.compile("(([a-zA-Z0-9_\\-\\.]+)@[a-zA-Z_]+?(?:\\.[a-zA-Z]{2,6}))+", Pattern.CASE_INSENSITIVE);
-	
-	/**
-	 * Replace links with HTML links.
-	 * Includes http, www, images, video, audio, email address.
-	 */
-	public static String linkHTML(String text) {
-		if (text == null || text.length() == 0) {
-			return "";
-		}
-		boolean http = text.indexOf("http") != -1;
-		boolean www = text.indexOf("www.") != -1;
-		boolean email = text.indexOf("@") != -1;
-		if (!http && !www && !email) {
-			return text;
-		}
-		if (text.indexOf("<") != -1 && text.indexOf(">") != -1) {
-			return text;
-		}
-		if (http) {
-			Matcher matcher = httpRegex.matcher(text);
-			StringBuffer sb = new StringBuffer();
-			while (matcher.find()) {
-				String url = matcher.group();
-		    	if (url.indexOf(".png") != -1 || url.indexOf(".jpg") != -1 || url.indexOf(".jpeg") != -1 || url.indexOf(".gif") != -1) {
-		    		url = "<a href='" + url + "' target='_blank'><img src='" + url + "' height='300'></a>";
-		    	} else if (url.indexOf(".mp4") != -1 || url.indexOf(".webm") != -1 || url.indexOf(".ogg") != -1) {
-		    		url = "<a href='" + url + "' target='_blank'><video src='" + url + "' height='300'></a>";
-		    	} else if (url.indexOf(".wav") != -1 || url.indexOf(".mp3") != -1) {
-		    		url = "<a href='" + url + "' target='_blank'><audio src='" + url + "' controls>audio</a>";
-		    	} else {
-		    		url = "<a href='" + url + "' target='_blank'>" + url + "</a>";
-		    	}
-				matcher.appendReplacement(sb, url);
-			}
-			matcher.appendTail(sb);
-			text = sb.toString();
-		} else if (www) {
-			Matcher matcher = wwwRegex.matcher(text);
-			StringBuffer sb = new StringBuffer();
-			while (matcher.find()) {
-				String url = matcher.group();
-				matcher.appendReplacement(sb, "<a href='http://" + url + "' target='_blank'>" + url + "</a>");
-			}
-			matcher.appendTail(sb);
-			text = sb.toString();
-		}
-		
-		if (email) {
-			Matcher matcher = emailRegex.matcher(text);
-			StringBuffer sb = new StringBuffer();
-			while (matcher.find()) {
-				String address = matcher.group();
-				matcher.appendReplacement(sb, "<a href='mailto://" + address + "' target='_blank'>" + address + "</a>");
-			}
-			matcher.appendTail(sb);
-			text = sb.toString();
-		}
-		return text;
-	}
-	
-
-	/**
-	 * Replace reserved HTML character with their HTML escape codes.
-	 */
-	public static String escapeHTML(String html) {
-		return html.replace("&", "&amp;")
-	    	.replace("<", "&lt;")
-	    	.replace(">", "&gt;")
-	    	.replace("\"", "&quot;")
-	    	.replace("`", "&#96;")
-	    	.replace("'", "&#39;");
-	}
-
-	/**
-	 * Strip the HTML tags from the text.
-	 */
-	public static String stripTags(String html) {
-		if (html == null) {
-			return "";
-		}
-		String result = html;
-		if ((html.indexOf('<') != -1) && (html.indexOf('>') != -1)) {
-			StringWriter writer = new StringWriter();
-			TextStream stream = new TextStream(html);
-			while (!stream.atEnd()) {
-				String text = stream.upTo('<');
-				writer.write(text);
-				int position = stream.getPosition();
-				stream.skip();
-				String word = stream.nextWord();
-				if (word != null) {
-					if (word.equals("p")) {
-						writer.write("\n\n");
-					} else if (word.equals("br")) {
-						writer.write("\n");
-					} else if (word.equals("div")) {
-						writer.write("\n");
-					}
-					stream.skipTo('>');
-					if (stream.atEnd()) {
-						stream.setPosition(position);
-						writer.write(stream.upToEnd());
-					} else {
-						stream.skip();
-					}
-				}
-			}
-			result = writer.toString();
-		}
-		if (result.contains("&")) {
-			result = result.replace("&#34;", "\"");
-			result = result.replace("&#96;", "`");
-			result = result.replace("&#39;", "'");
-			result = result.replace("&#64;", "@");
-			result = result.replace("&#61;", "=");
-			result = result.replace("&lt;", "<");
-			result = result.replace("&gt;", ">");
-		}
-		return result;
-	}
-
-	/**
-	 * Format the text that may be HTML, or may be text, or markup, or a mix.
-	 */
-	public static String formatHTMLOutput(String text) {
-		if (text == null) {
-			return "";
-		}
-		int index = text.indexOf('<');
-		int index2 = text.indexOf('>');
-		boolean isHTML = (index != -1) && (index2 > index);
-		boolean isMixed = isHTML && text.contains("[code]");
-		if (isHTML && !isMixed) {
-			return text;
-		}
-		if (!isMixed && ((index != -1) || (index2 != -1))) {
-			text = text.replace("<", "&lt;");
-			text = text.replace(">", "&gt;");
-		}
-		TextStream stream = new TextStream(text);
-		StringWriter writer = new StringWriter();
-		boolean bullet = false;
-		boolean nbullet = false;
-		while (!stream.atEnd()) {
-			String line = stream.nextLine();
-			if (!isMixed && (line.contains("http://") || line.contains("https://"))) {
-				line = Utils.linkHTML(line);
-			}
-			TextStream lineStream = new TextStream(line);
-			boolean firstWord = true;
-			boolean span = false;
-			boolean cr = true;
-			while (!lineStream.atEnd()) {
-				while (!isMixed && firstWord && lineStream.peek() == ' ') {
-					lineStream.next();
-					writer.write("&nbsp;");
-				}
-				String whitespace = lineStream.nextWhitespace();
-				writer.write(whitespace);
-				if (lineStream.atEnd()) {
-					break;
-				}
-				String word = lineStream.nextWord();
-				if (!isMixed && nbullet && firstWord && !word.equals("#")) {
-					writer.write("</ol>\n");
-					nbullet = false;
-				} else if (!isMixed && bullet && firstWord && !word.equals("*")) {
-					writer.write("</ul>\n");
-					bullet = false;
-				}
-				if (firstWord && word.equals("[")) {
-					String peek = lineStream.peekWord();
-					if ("code".equals(peek)) {
-						lineStream.nextWord();
-						String next = lineStream.nextWord();
-						String lang = "javascript";
-						int lines = 20;
-						if ("lang".equals(next)) {
-							lineStream.skip();
-							lang = lineStream.nextWord();
-							if ("\"".equals(lang)) {
-								lang = lineStream.nextWord();
-								lineStream.skip();
-							}
-							next = lineStream.nextWord();
-						}
-						if ("lines".equals(next)) {
-							lineStream.skip();
-							String value = lineStream.nextWord();
-							if ("\"".equals(value)) {
-								value = lineStream.nextWord();
-								lineStream.skip();
-							}
-							lineStream.skip();
-							try {
-								lines = Integer.valueOf(value);
-							} catch (NumberFormatException ignore) {}
-						}
-						String id = "code" + stream.getPosition();
-						writer.write("<div style=\"width:100%;height:" + lines * 14 + "px;max-width:none\" id=\"" + id + "\">");
-						String code = lineStream.upToAll("[code]");
-						if (code.indexOf('<') != -1) {
-							code = code.replace("<", "&lt;");
-						}
-						if (code.indexOf('>') != -1) {
-							code = code.replace(">", "&gt;");
-						}
-						writer.write(code);
-						while (lineStream.atEnd() && !stream.atEnd()) {
-							line = stream.nextLine();
-							lineStream = new TextStream(line);
-							while (lineStream.peek() == ':') {
-								lineStream.next();
-								writer.write("&nbsp;&nbsp;&nbsp;&nbsp;");								
-							}
-							code = lineStream.upToAll("[code]");
-							if (code.indexOf('<') != -1) {
-								code = code.replace("<", "&lt;");
-							}
-							if (code.indexOf('>') != -1) {
-								code = code.replace(">", "&gt;");
-							}
-							writer.write(code);
-						}
-						lineStream.skip("[code]".length());
-						writer.write("</div>\n");
-
-						writer.write("<script>\n");
-						writer.write("var " + id + " = ace.edit('" + id + "');\n");
-						writer.write(id + ".getSession().setMode('ace/mode/" + lang + "');\n");
-						writer.write(id + ".setReadOnly(true);\n");
-						writer.write("</script>\n");
-					} else {
-						writer.write(word);
-					}
-				} else if (!isMixed && firstWord && word.equals("=")) {
-					int count = 2;
-					String token = word;
-					while (!lineStream.atEnd() && lineStream.peek() == '=') {
-						lineStream.skip();
-						count++;
-						token = token + "=";
-					}
-					String header = lineStream.upToAll(token);
-					if (lineStream.atEnd()) {
-						writer.write(token);
-						writer.write(header);
-					} else {
-						lineStream.skip(token.length());
-						writer.write("<h");
-						writer.write(String.valueOf(count));
-						writer.write(">");
-						writer.write(header);
-						writer.write("</h");
-						writer.write(String.valueOf(count));
-						writer.write(">");
-						cr = false;
-					}
-				} else if (!isMixed && firstWord && word.equals(":")) {
-					span = true;
-					int indent = 1;
-					while (!lineStream.atEnd() && lineStream.peek() == ':') {
-						lineStream.skip();				
-						indent++;
-					}
-					writer.write("<span style=\"display:inline-block;text-indent:");
-					writer.write(String.valueOf(indent * 20));
-					writer.write("px;\">");	
-				} else if (!isMixed && firstWord && word.equals("*")) {
-					if (!bullet) {
-						writer.write("<ul>");
-						bullet = true;
-					}
-					writer.write("<li>");
-					cr = false;
-				} else if (!isMixed && firstWord && word.equals("#")) {
-					if (!nbullet) {
-						writer.write("<ol>");
-						nbullet = true;
-					}
-					writer.write("<li>");
-					cr = false;
-				} else {
-					writer.write(word);
-				}
-				firstWord = false;
-			}
-			if (!isMixed && span) {
-				writer.write("</span>");
-			}
-			if (!isMixed && cr) { 
-				writer.write("<br/>\n");
-			}
-		}
-		if (!isMixed && bullet) {
-			writer.write("</ul>");
-		}
-		if (!isMixed && nbullet) {
-			writer.write("</ol>");
-		}
-		return writer.toString();
-	}
-	
-	public static String displayTimestamp(Date date) {
-		if (date == null) {
-			return "";
-		}
-		StringWriter writer = new StringWriter();
-		Calendar today = Calendar.getInstance();
-		Calendar calendar = Calendar.getInstance();
-		calendar.setTime(date);
-		if (calendar.get(Calendar.YEAR) == today.get(Calendar.YEAR)
-				&& calendar.get(Calendar.DAY_OF_YEAR) == today.get(Calendar.DAY_OF_YEAR)) {
-			writer.write("Today");
-		} else if (calendar.get(Calendar.YEAR) == today.get(Calendar.YEAR)
-				&& calendar.get(Calendar.DAY_OF_YEAR) == (today.get(Calendar.DAY_OF_YEAR) - 1)) {
-			writer.write("Yesterday");
-		} else {
-			writer.write(calendar.getDisplayName(Calendar.MONTH, Calendar.SHORT, Locale.US));
-			writer.write(" ");
-			writer.write(String.valueOf(calendar.get(Calendar.DAY_OF_MONTH)));
-			if (calendar.get(Calendar.YEAR) != today.get(Calendar.YEAR)) {
-				writer.write(" ");
-				writer.write(String.valueOf(calendar.get(Calendar.YEAR)));
-			}
-		}
-		writer.write(", ");
-		writer.write(String.valueOf(calendar.get(Calendar.HOUR_OF_DAY)));
-		writer.write(":");
-		if (calendar.get(Calendar.MINUTE) < 10) {
-			writer.write("0");
-		}
-		writer.write(String.valueOf(calendar.get(Calendar.MINUTE)));
-		
-		return writer.toString();
-	}
-	
-	public static String displayTime(Date date) {
-		if (date == null) {
-			return "";
-		}
-		StringWriter writer = new StringWriter();
-		Calendar calendar = Calendar.getInstance();
-		calendar.setTime(date);
-		writer.write(String.valueOf(calendar.get(Calendar.HOUR_OF_DAY)));
-		writer.write(":");
-		if (calendar.get(Calendar.MINUTE) < 10) {
-			writer.write("0");
-		}
-		writer.write(String.valueOf(calendar.get(Calendar.MINUTE)));
-		writer.write(":");
-		if (calendar.get(Calendar.SECOND) < 10) {
-			writer.write("0");
-		}
-		writer.write(String.valueOf(calendar.get(Calendar.SECOND)));
-		
-		return writer.toString();
-	}
-	
-	public static String displayDate(Date date) {
-		if (date == null) {
-			return "";
-		}
-		StringWriter writer = new StringWriter();
-		Calendar today = Calendar.getInstance();
-		Calendar calendar = Calendar.getInstance();
-		calendar.setTime(date);
-		if (calendar.get(Calendar.YEAR) == today.get(Calendar.YEAR)
-				&& calendar.get(Calendar.DAY_OF_YEAR) == today.get(Calendar.DAY_OF_YEAR)) {
-			writer.write("Today");
-		} else if (calendar.get(Calendar.YEAR) == today.get(Calendar.YEAR)
-				&& calendar.get(Calendar.DAY_OF_YEAR) == (today.get(Calendar.DAY_OF_YEAR) - 1)) {
-			writer.write("Yesterday");
-		} else {
-			writer.write(calendar.getDisplayName(Calendar.MONTH, Calendar.SHORT, Locale.US));
-			writer.write(" ");
-			writer.write(String.valueOf(calendar.get(Calendar.DAY_OF_MONTH)));
-			if (calendar.get(Calendar.YEAR) != today.get(Calendar.YEAR)) {
-				writer.write(" ");
-				writer.write(String.valueOf(calendar.get(Calendar.YEAR)));
-			}
-		}
-		
-		return writer.toString();
-	}
-	
-	/**
-	 * Capitalize the first character of the string.
-	 */
-	public static String capitalize(String text) {
-		if (text.length() == 0) {
-			return text;
-		}
-		return Character.toUpperCase(text.charAt(0)) + text.substring(1, text.length());
-	}
-	
-	public static Random random() {
-		return random;
-	}
-	
-	public static int random(int max) {
-		return random().nextInt(max);
-	}
-	
-	public static <T> T random(List<T> list) {
-		if ((list == null) || list.isEmpty()) {
-			return null;
-		}
-		return list.get(random().nextInt(list.size()));
-	}
-	/**
-	 * Get the contents of the stream to a .self file and parse it.
-	 */
-	public static String loadTextFile(InputStream stream, String encoding, int maxSize, boolean finish) {
-		if (encoding.trim().isEmpty()) {
-			encoding = "UTF-8";
-		}
-
-	    // FEFF because this is the Unicode char represented by the UTF-8 byte order mark (EF BB BF).
-	    String UTF8_BOM = "\uFEFF";
-	    
-		StringWriter writer = new StringWriter();
-		InputStreamReader reader = null;
-		try {
-			reader = new InputStreamReader(stream, encoding);
-			int size = 0;
-			int next = reader.read();
-			boolean first = true;
-			while (next >= 0) {
-				if (first && next == UTF8_BOM.charAt(0)) {
-					// skip
-				} else {
-					writer.write(next);
-				}
-				next = reader.read();
-				if (size > maxSize) {
-					throw new BotException("File size limit exceeded: " + size + " > " + maxSize + " token: " + next);
-				}
-				size++;
-			}
-		} catch (IOException exception) {
-			throw new BotException("IO Error: " + exception.getMessage(), exception);
-		} finally {
-			if (reader != null && finish) {
-				try {
-					reader.close();
-				} catch (IOException ignore) {}
-			}
-			if (stream != null && finish) {
-				try {
-					stream.close();
-				} catch (IOException ignore) {}
-			}
-		}
-		return writer.toString();
-	}
-	
-	public static <T> T random(Collection<T> collection) {
-		if ((collection == null) || collection.isEmpty()) {
-			return null;
-		}
-		int value = random().nextInt(collection.size());
-		int index = 0;
-		for (T element : collection) {
-			if (index == value) {
-				return element;				
-			}
-			index++;
-		}
-		return null;
-	}
-}
\ No newline at end of file
diff --git a/PizzaBotOffline/entry/src/main/resources/base/layout/activity_chat.xml b/PizzaBotOffline/entry/src/main/resources/base/layout/ability_chat.xml
similarity index 99%
rename from PizzaBotOffline/entry/src/main/resources/base/layout/activity_chat.xml
rename to PizzaBotOffline/entry/src/main/resources/base/layout/ability_chat.xml
index d64dedb4648323df0c3db2e30945b05df444b858..31fb652344cf158f0e215e115ac6d38c8d02279d 100644
--- a/PizzaBotOffline/entry/src/main/resources/base/layout/activity_chat.xml
+++ b/PizzaBotOffline/entry/src/main/resources/base/layout/ability_chat.xml
@@ -1,7 +1,7 @@
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
@@ -129,6 +129,7 @@
             ohos:height="match_parent"
             ohos:width="match_parent"
             >
+
             <DirectionalLayout
                 ohos:id="$+id:direction_yes"
                 ohos:height="match_content"
@@ -137,22 +138,24 @@
                 ohos:padding="10vp"
                 ohos:visibility="hide"
                 >
+
                 <Text
                     ohos:height="match_content"
                     ohos:width="match_parent"
+                    ohos:multiple_lines="true"
                     ohos:text="$string:response_01"
                     ohos:text_size="14fp"
-                    ohos:multiple_lines="true"
                     />
+
                 <Button
                     ohos:id="$+id:button_yes"
                     ohos:height="match_content"
                     ohos:width="match_content"
-                    ohos:text_size="14fp"
-                    ohos:text="Yes"
+                    ohos:background_element="$graphic:button_bg"
                     ohos:left_padding="5vp"
                     ohos:right_padding="5vp"
-                    ohos:background_element="$graphic:button_bg"
+                    ohos:text="Yes"
+                    ohos:text_size="14fp"
                     />
             </DirectionalLayout>
 
@@ -164,60 +167,67 @@
                 ohos:top_padding="10vp"
                 ohos:visibility="hide"
                 >
+
                 <Text
                     ohos:height="match_content"
                     ohos:width="match_content"
+                    ohos:multiple_lines="true"
                     ohos:text="Would like a "
                     ohos:text_size="14fp"
-                    ohos:multiple_lines="true"
                     />
+
                 <Button
                     ohos:id="$+id:button_small"
                     ohos:height="match_content"
                     ohos:width="match_content"
-                    ohos:text_size="14fp"
-                    ohos:text="small"
+                    ohos:background_element="$graphic:button_bg"
                     ohos:left_padding="5vp"
-                    ohos:right_padding="5vp"
                     ohos:right_margin="5vp"
-                    ohos:background_element="$graphic:button_bg"
+                    ohos:right_padding="5vp"
+                    ohos:text="small"
+                    ohos:text_size="14fp"
                     />
+
                 <Button
                     ohos:id="$+id:button_mid"
                     ohos:height="match_content"
                     ohos:width="match_content"
-                    ohos:text_size="14fp"
-                    ohos:text="medium"
+                    ohos:background_element="$graphic:button_bg"
                     ohos:left_padding="5vp"
-                    ohos:right_padding="5vp"
                     ohos:right_margin="5vp"
-                    ohos:background_element="$graphic:button_bg"
+                    ohos:right_padding="5vp"
+                    ohos:text="medium"
+                    ohos:text_size="14fp"
                     />
+
                 <Text
                     ohos:height="match_content"
                     ohos:width="match_content"
+                    ohos:multiple_lines="true"
                     ohos:text=",or"
                     ohos:text_size="14fp"
-                    ohos:multiple_lines="true"
                     />
+
                 <Button
                     ohos:id="$+id:button_big"
                     ohos:height="match_content"
                     ohos:width="match_content"
-                    ohos:text_size="14fp"
-                    ohos:text="large"
+                    ohos:background_element="$graphic:button_bg"
                     ohos:left_padding="5vp"
                     ohos:right_padding="5vp"
-                    ohos:background_element="$graphic:button_bg"
+                    ohos:text="large"
+                    ohos:text_size="14fp"
                     />
+
                 <Text
                     ohos:height="match_content"
                     ohos:width="match_content"
+                    ohos:multiple_lines="true"
                     ohos:text="pizza?"
                     ohos:text_size="14fp"
-                    ohos:multiple_lines="true"
                     />
             </DirectionalLayout>
+
             <DirectionalLayout
                 ohos:id="$+id:direction_type"
                 ohos:height="match_content"
@@ -226,13 +236,15 @@
                 ohos:padding="10vp"
                 ohos:visibility="hide"
                 >
+
                 <Text
                     ohos:height="match_content"
                     ohos:width="match_content"
                     ohos:text="$string:response_05"
-                    ohos:text_size="14fp"
                     ohos:text_alignment="vertical_center"
+                    ohos:text_size="14fp"
                     />
+
                 <Button
                     ohos:id="$+id:button_type"
                     ohos:height="22vp"
@@ -241,15 +253,17 @@
                     ohos:text_alignment="vertical_center"
                     />
             </DirectionalLayout>
+
             <Text
                 ohos:id="$+id:textInfo"
                 ohos:height="match_content"
                 ohos:width="match_parent"
-                ohos:top_padding="10vp"
-                ohos:text_size="14fp"
                 ohos:multiple_lines="true"
                 ohos:text_alignment="vertical_center"
+                ohos:text_size="14fp"
+                ohos:top_padding="10vp"
                 />
+
             <ohos.agp.components.webengine.WebView
                 ohos:id="$+id:responseText"
                 ohos:height="match_content"
diff --git a/README.md b/README.md
index 107d7c0822d9850c6ec7b8456ec056fb2c202129..eef39d62e9a7a7b7a32201e291e70b0563231f1c 100644
--- a/README.md
+++ b/README.md
@@ -5,10 +5,10 @@
 - 项目名称：BotLibre
 - 所属系列：OpenHarmony的第三方组件适配移植
 - 功能：人工智能、nlp、聊天机器人、虚拟代理、社交媒体自动化和实时聊天自动化的开源平台
-- 基线版本：master
 - 项目移植状态：主功能完成
 - 调用差异：无
 - 开发版本：sdk6，DevEco Studio2.2 Beta1
+- 基线版本：master
 
 ## 效果演示
 
@@ -23,7 +23,7 @@ Demo中调用library组件，然后通过五个功能操作展示组件。
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/SantaBot/README.md b/SantaBot/README.md
index da53e45950ff0115bf698f332ac3840f0f3ac027..e6e449d274362b7985217a28580c06a146e5cf8b 100644
--- a/SantaBot/README.md
+++ b/SantaBot/README.md
@@ -5,10 +5,10 @@
 - 项目名称：BotLibre
 - 所属系列：OpenHarmony的第三方组件适配移植
 - 功能：人工智能、nlp、聊天机器人、虚拟代理、社交媒体自动化和实时聊天自动化的开源平台
-- 基线版本：master
 - 项目移植状态：主功能完成
 - 调用差异：无
 - 开发版本：sdk6，DevEco Studio2.2 Beta1
+- 基线版本：master
 
 ## 效果演示
 
@@ -23,7 +23,7 @@ Demo中调用library组件，然后通过五个功能操作展示组件。
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/SantaBot/build.gradle b/SantaBot/build.gradle
index a4bbee50c84428507c792bf978676f0ff6fe17a8..eaa69ab6660caa5e71799dc98afc9a8394db0e6c 100644
--- a/SantaBot/build.gradle
+++ b/SantaBot/build.gradle
@@ -2,6 +2,17 @@
 apply plugin: 'com.huawei.ohos.app'
 
 ohos {
+    signingConfigs {
+        debug {
+            storeFile file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_890086000102149657.p12')
+            storePassword '000000186F2072CDBF4F29D6F1F0A082391252B4988AF3FE87F748FB333B24A91A4FB04349737F41'
+            keyAlias = 'debugKey'
+            keyPassword '00000018EC969D3028C3D7289509AB8E7AA74A5BFA61B700CB8351942CD39BC744D4C0C139153DC9'
+            signAlg = 'SHA256withECDSA'
+            profile file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_sdk_890086000102149657.p7b')
+            certpath file('C:\\Users\\258767-shengyu\\.ohos\\config\\auto_debug_890086000102149657.cer')
+        }
+    }
     compileSdkVersion 6
     defaultConfig {
         compatibleSdkVersion 5
diff --git a/SantaBot/entry/src/main/config.json b/SantaBot/entry/src/main/config.json
index 12910a3ffa803d2f6bd1458f8e29981427c05e0d..a8729f7fb0c6be7ef628b859999529c28a6d9531 100644
--- a/SantaBot/entry/src/main/config.json
+++ b/SantaBot/entry/src/main/config.json
@@ -44,53 +44,53 @@
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.avatar.AvatarSelection",
+        "name": "org.botlibre.sdk.ability.avatar.AvatarSelection",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.LoginAbility",
+        "name": "org.botlibre.sdk.ability.LoginAbility",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.CreateUserAbility",
+        "name": "org.botlibre.sdk.ability.CreateUserAbility",
         "orientation": "unspecified",
         "icon": "$media:icon",
         "type": "page",
         "launchType": "standard"
       },
       {
-        "name": "org.botlibre.sdk.activityy.ChatAbility",
+        "name": "org.botlibre.sdk.ability.ChatAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.war.StartWarAbility",
+        "name": "org.botlibre.sdk.ability.war.StartWarAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.LibreAbility",
+        "name": "org.botlibre.sdk.ability.LibreAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.BotSearchAbility",
+        "name": "org.botlibre.sdk.ability.BotSearchAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.SearchAbility",
+        "name": "org.botlibre.sdk.ability.SearchAbility",
         "description": "",
         "type": "page"
       },
       {
-        "name": "org.botlibre.sdk.activityy.HelpAbility",
+        "name": "org.botlibre.sdk.ability.HelpAbility",
         "description": "",
         "type": "page"
       }
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/Credentials.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/Credentials.java
index 4846f048f602de4b9a59d0382110e6640dd9237a..ace1a72b4ccef374c8aaac21649152bd2d1ea082 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/Credentials.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/Credentials.java
@@ -50,6 +50,8 @@ public class Credentials {
 	
 	/**
 	 * Sets the hosted service server url, i.e. http://www.paphuslivechat.com
+	 *
+	 * @param url String
 	 */
 	public void setUrl(String url) {
 		this.url = url;
@@ -61,6 +63,8 @@ public class Credentials {
 
 	/**
 	 * Sets the server host name, i.e. www.paphuslivechat.com
+	 *
+	 * @param host String
 	 */
 	public void setHost(String host) {
 		this.host = host;
@@ -72,6 +76,8 @@ public class Credentials {
 
 	/**
 	 * Sets an app url postfix, this is normally not required, i.e. "".
+	 *
+	 * @param app String
 	 */
 	public void setApp(String app) {
 		this.app = app;
@@ -79,16 +85,10 @@ public class Credentials {
 
 	/**
 	 * Returns your application's unique identifier.
+	 *
+	 * @return String
 	 */
 	public String getApplicationId() {
 		return applicationId;
 	}
-
-	/**
-	 * Sets your application's unique identifier.
-	 * You can obtain your application id from your user details page on the hosting website.
-	 */
-	public void setApplicationId(String applicationId) {
-		this.applicationId = applicationId;
-	}
 }
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
index 97b136983accbc0132b1729ced2df22fef4f3f2e..fe87c7da591192089fec8aea2a159b554a609fbb 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/LiveChatConnection.java
@@ -42,6 +42,9 @@ public class LiveChatConnection {
     /**
      * Create a new connection with the application credentials and the listener.
      * The listener will be notified asynchronously of messages and events.
+	 *
+	 * @param credentials Credentials
+	 * @param listener LiveChatListener
      */
 	public LiveChatConnection(Credentials credentials, LiveChatListener listener) {
 		this.credentials = credentials;
@@ -52,6 +55,9 @@ public class LiveChatConnection {
 	 * Connection to the live chat server channel.
 	 * Validate the user credentials.
 	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
+	 *
+	 * @param channel ChannelConfig
+	 * @param user UserConfig
 	 */
 	public void connect(ChannelConfig channel, UserConfig user) {
 		this.channel = channel;
@@ -113,178 +119,63 @@ public class LiveChatConnection {
 		}
 	}
 
-	/**
-	 * Sent a text message to the channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 * Note, the listener will receive its own messages.
-	 */
-	public void sendMessage(String message) {
-		checkSocket();
-		if (message == null) {
-			return;
-		}
-		this.socket.sendTextMessage(message);
-	}
-
-	/**
-	 * Accept a private request.
-	 * This is also used by an operator to accept the top of the waiting queue.
-	 * This can also be used by a user to chat with the channel bot.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void accept() {
-		checkSocket();
-		this.socket.sendTextMessage("accept");
-	}
-
-	/**
-	 * Test the connection.
-	 * A pong message will be returned, this message will not be broadcast to the channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void ping() {
-		checkSocket();
-		this.socket.sendTextMessage("ping");
-	}
-
-	/**
-	 * Exit from the current private channel.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void exit() {
-		checkSocket();
-		this.socket.sendTextMessage("exit");
-	}
-
-	/**
-	 * Request a private chat session with a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void pvt(String user) {
-		checkSocket();
-		this.socket.sendTextMessage("pvt: " + user);
-	}
-
-	/**
-	 * Boot a user from the channel.
-	 * You must be a channel administrator to boot a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void boot(String user) {
-		checkSocket();
-		this.socket.sendTextMessage("boot: " + user);
-	}
-
-	/**
-	 * Send a private message to a user.
-	 * This call is asynchronous, any error or success with be sent as a separate message to the listener.
-	 */
-	public void whisper(String user, String message) {
-		checkSocket();
-		this.socket.sendTextMessage("whisper:" + user + ": " + message);
-	}
-
-	/**
-	 * Disconnect from the channel.
-	 */
-	public void disconnect() {
-    	this.keepAlive = false;
-    	if (this.keepAliveThread != null) {
-    		this.keepAliveThread.interrupt();
-    	}
-    	if (this.socket != null) {
-    		this.socket.disconnect();
-    	}
-	}
- 
-    protected void runKeepAlive() {
-    	this.keepAliveThread = new Thread() {
-    		public void run() {
-    			while (keepAlive) {
-	    			sendMessage("ping");
-	    			try {
-	    				Thread.sleep(600000);
-	    			} catch (InterruptedException exception) {
-	    				return;
-	    			}
-    			}
-    		}
-    	};
-    	this.keepAliveThread.start();
-    }
-    
-    public boolean isDebug() {
-		return debug;
-	}
-
-	/**
-	 * Enable debugging messages (logged to System.out).
-	 */
-	public void setDebug(boolean debug) {
-		this.debug = debug;
-	}
-
 	/**
 	 * Return the current channel.
+	 *
+	 * @return ChannelConfig
 	 */
 	public ChannelConfig getChannel() {
 		return channel;
 	}
 
-	protected void setChannel(ChannelConfig channel) {
-		this.channel = channel;
-	}
-
 	/**
 	 * Return the current user.
+	 *
+	 * @return the current user
 	 */
 	public UserConfig getUser() {
 		return user;
 	}
 
+	/**
+	 * setUser
+	 *
+	 * @param user UserConfig
+	 * */
 	protected void setUser(UserConfig user) {
 		this.user = user;
 	}
 
 	/**
 	 * Return the current application credentials.
+	 *
+	 * @return current application credentials
 	 */
 	public Credentials getCredentials() {
 		return credentials;
 	}
 
-	protected void setCredentials(Credentials credentials) {
-		this.credentials = credentials;
-	}
-
+	/**
+	 * getListener
+	 *
+	 * @return LiveChatListener
+	 * */
 	public LiveChatListener getListener() {
 		return listener;
 	}
 
+    /**
+	 * setListener
+	 *
+	 * @param listener LiveChatListener
+	 * */
 	public void setListener(LiveChatListener listener) {
 		this.listener = listener;
 	}
 
 	/**
-	 * Return if the connection will be kept alive, and not allowed to timeout due to inAbility.
-	 */
-	public boolean isKeepAlive() {
-		return keepAlive;
-	}
-
-	/**
-	 * Set if the connection should be kept alive, and not allowed to timeout due to inAbility.
-	 */
-	public void setKeepAlive(boolean keepAlive) {
-		this.keepAlive = keepAlive;
-    	if (this.keepAlive) {
-    		runKeepAlive();
-    	} else if (this.keepAliveThread != null) {
-    		this.keepAliveThread.interrupt();
-    		this.keepAliveThread = null;
-    	}
-    }
-	
+	 * checkSocket
+	 * */
 	protected void checkSocket() {
 		if (this.socket == null) {
 			throw new SDKException("Not connected");
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/MainAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/MainAbility.java
index 8679d66988c4a3c0b931b08136570096db0d781e..ede1ddbaceb27b79c67b4b10127bac78e240b4c8 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/MainAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/MainAbility.java
@@ -1,23 +1,22 @@
 package org.botlibre.sdk;
 
-import org.botlibre.sdk.activityy.BotSearchAbility;
-import org.botlibre.sdk.activityy.CreateUserAbility;
-import org.botlibre.sdk.activityy.HelpAbility;
-import org.botlibre.sdk.activityy.LibreAbility;
-import org.botlibre.sdk.activityy.ListTemplateView;
-import org.botlibre.sdk.activityy.LoginAbility;
-import org.botlibre.sdk.activityy.actions.HttpConnectAction;
-import org.botlibre.sdk.activityy.actions.HttpFetchAction;
-import org.botlibre.sdk.activityy.actions.HttpFetchOrCreateAction;
-import org.botlibre.sdk.activityy.actions.HttpGetImageAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.actions.HttpGetTemplatesAction;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.dialog.LanguageDialogBuilder;
-import org.botlibre.sdk.activityy.dialog.SpinnerDialogBuilder;
-import org.botlibre.sdk.activityy.listener.LanguageListener;
-import org.botlibre.sdk.activityy.listener.SelectListener;
-import org.botlibre.sdk.activityy.war.StartWarAbility;
+import org.botlibre.sdk.ability.BotSearchAbility;
+import org.botlibre.sdk.ability.CreateUserAbility;
+import org.botlibre.sdk.ability.HelpAbility;
+import org.botlibre.sdk.ability.LibreAbility;
+import org.botlibre.sdk.ability.ListTemplateView;
+import org.botlibre.sdk.ability.LoginAbility;
+import org.botlibre.sdk.ability.actions.HttpConnectAction;
+import org.botlibre.sdk.ability.actions.HttpFetchAction;
+import org.botlibre.sdk.ability.actions.HttpFetchOrCreateAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.actions.HttpGetTemplatesAction;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.dialog.LanguageDialogBuilder;
+import org.botlibre.sdk.ability.dialog.SpinnerDialogBuilder;
+import org.botlibre.sdk.ability.listener.LanguageListener;
+import org.botlibre.sdk.ability.listener.SelectListener;
+import org.botlibre.sdk.ability.war.StartWarAbility;
 import org.botlibre.sdk.config.AvatarConfig;
 import org.botlibre.sdk.config.AvatarMedia;
 import org.botlibre.sdk.config.BotModeConfig;
@@ -67,7 +66,6 @@ import ohos.security.SystemPermission;
 import ohos.utils.net.Uri;
 import org.botlibre.knowledge.micro.MicroMemory;
 
-import javax.swing.text.View;
 import java.awt.*;
 import java.io.File;
 import java.util.ArrayList;
@@ -128,7 +126,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     /**
      * If you are building a single instance app, then you can set the instance id or name here,
-     * and use this activity to launch it.
+     * and use this  to launch it.
      */
     public static String launchInstanceId = ""; // i.e. "171"
     public static String launchInstanceName = "Pizza Bot"; // i.e. "Help Bot"
@@ -139,7 +137,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 
     /**
      * If you are building a single instance app, then you can set the launchType to
-     * have this activity launch the bot, forum, or channel.
+     * have this  launch the bot, forum, or channel.
      */
     public static LaunchType launchType = LaunchType.Bot;
 
@@ -441,49 +439,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         }
     }
 
-    public static boolean isExternalStorageDocument(Uri uri) {
-        return "com.ohos.externalstorage.documents".equals(uri.getDecodedAuthority());
-    }
-
-    /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is DownloadsProvider.
-     */
-    public static boolean isDownloadsDocument(Uri uri) {
-        return "com.ohos.providers.downloads.documents".equals(uri.getDecodedAuthority());
-    }
-
-    /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is MediaProvider.
-     */
-    public static boolean isMediaDocument(Uri uri) {
-        return "com.ohos.providers.media.documents".equals(uri.getDecodedAuthority());
-    }
-
-    /**
-     * @param uri The Uri to check.
-     * @return Whether the Uri authority is Google Photos.
-     */
-
-    public static boolean isGooglePhotosUri(Uri uri) {
-        return "com.google.ohos.apps.photos.content".equals(uri.getDecodedAuthority());
-    }
-
-    public static String getFileNameFromPath(String path) {
-        int index = path.lastIndexOf("/");
-        return path.substring(index + 1, path.length());
-    }
-
-//    public static String getFileTypeFromPath(String path) {
-//        int index = path.lastIndexOf(".");
-//        String ext = path.substring(index + 1, path.length());
-//        if (ext.equalsIgnoreCase("webm")) {
-//            return "video/webm";
-//        }
-//        return MimeTypeMap.getSingleton().getMimeTypeFromExtension(ext);
-//    }
-
     public static boolean isTablet(Context context) {
 //        return (context.getResourceManager().getConfiguration().isLayoutRTL
 //                & Configuration.AUTO_MODE) >= Configuration.AUTO_MODE;
@@ -491,7 +446,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     @SuppressWarnings("rawtypes")
-    public static Class getActivity(WebMediumConfig config) {
+    public static Class getAbility(WebMediumConfig config) {
         if (config instanceof ChannelConfig) {
 //            return ChannelAbility.class; //====================
         } else if (config instanceof ForumConfig) {
@@ -510,7 +465,7 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         return null;
     }
 
-    public static void error(String message, Exception exception, Ability activity) {
+    public static void error(String message, Exception exception, Ability ability) {
         try {
             if (DEBUG) {
                 System.out.println(String.valueOf(message));
@@ -524,13 +479,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             if (message.contains("<html>")) {
                 message = "Server Error, ensure you are connected to the Internet";
             }
-            MainAbility.showMessage(null,message, activity);
+            MainAbility.showMessage(null,message, ability);
         } catch (Throwable error) {
             error.printStackTrace();
         }
     }
 
-    public static void errorInfo(int type,String message, Exception exception, Ability activity) {
+    public static void errorInfo(int type,String message, Exception exception, Ability ability) {
         try {
             if (DEBUG) {
                 System.out.println(String.valueOf(message));
@@ -544,18 +499,18 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             if (message.contains("<html>")) {
                 message = "Server Error, ensure you are connected to the Internet";
             }
-            MainAbility.showMessageInfo(type,null,message, activity);
+            MainAbility.showMessageInfo(type,null,message, ability);
         } catch (Throwable error) {
             error.printStackTrace();
         }
     }
 
-    public static void showMessage(String title, String message, Ability activity) {
-        CommonDialog mCommonDialog = new CommonDialog(activity);
+    public static void showMessage(String title, String message, Ability ability) {
+        CommonDialog mCommonDialog = new CommonDialog(ability);
         Optional<Display>
-                display = DisplayManager.getInstance().getDefaultDisplay(activity);
+                display = DisplayManager.getInstance().getDefaultDisplay(ability);
         DisplayAttributes displayAttributes = display.get().getAttributes();
-        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(activity).
+        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability).
                 parse(ResourceTable.Layout_content_dialog,
                         null, false);
         mCommonDialog.setContentCustomComponent(layout)
@@ -579,12 +534,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public void showLogin(String title, String message, Ability activity) {
-        CommonDialog mCommonDialog = new CommonDialog(activity);
+    public void showLogin(String title, String message, Ability ability) {
+        CommonDialog mCommonDialog = new CommonDialog(ability);
         Optional<Display>
-                display = DisplayManager.getInstance().getDefaultDisplay(activity);
+                display = DisplayManager.getInstance().getDefaultDisplay(ability);
         DisplayAttributes displayAttributes = display.get().getAttributes();
-        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(activity).
+        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability).
                 parse(ResourceTable.Layout_content_dialog,
                         null, false);
         mCommonDialog.setContentCustomComponent(layout)
@@ -610,12 +565,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     public static Text execcontentinfo;
-    public static void showMessageInfo(int type,String title, String message, Ability activity) {
-        CommonDialog mCommonDialog = new CommonDialog(activity);
+    public static void showMessageInfo(int type,String title, String message, Ability ability) {
+        CommonDialog mCommonDialog = new CommonDialog(ability);
         Optional<Display>
-                display = DisplayManager.getInstance().getDefaultDisplay(activity);
+                display = DisplayManager.getInstance().getDefaultDisplay(ability);
         DisplayAttributes displayAttributes = display.get().getAttributes();
-        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(activity).
+        DirectionalLayout layout = (DirectionalLayout) LayoutScatter.getInstance(ability).
                 parse(ResourceTable.Layout_exception_dialog,
                         null, false);
         mCommonDialog.setContentCustomComponent(layout)
@@ -645,12 +600,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public static void showMessage(String message, Ability activity) {
-        showMessage(null, message, activity);
+    public static void showMessage(String message, Ability ability) {
+        showMessage(null, message, ability);
     }
 
-    public static void prompt(String message, Ability activity, TextField text, IDialog.ClickedListener listener) {
-        CommonDialog dialog = new CommonDialog(activity);
+    public static void prompt(String message, Ability ability, TextField text, IDialog.ClickedListener listener) {
+        CommonDialog dialog = new CommonDialog(ability);
         dialog.setContentText(message);
         dialog.setContentCustomComponent(text);
         dialog.setButton(0, "OK", listener);
@@ -683,8 +638,8 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         builder.show();
     }
 
-    public static void confirm(String message, Ability activity, Boolean cancelable, IDialog.ClickedListener listener) {
-        CommonDialog dialog = new CommonDialog(activity);
+    public static void confirm(String message, Ability ability, Boolean cancelable, IDialog.ClickedListener listener) {
+        CommonDialog dialog = new CommonDialog(ability);
         dialog.setTitleText("Pizza Bot");
         dialog.setContentText(message);
         dialog.setButton(0, "Yes", listener);
@@ -695,10 +650,10 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         dialog.show();
     }
 
-    public static List<InstanceConfig> getAllTemplates(Ability activity) {
+    public static List<InstanceConfig> getAllTemplates(Ability ability) {
         if (templates == null) {
             try {
-                HttpGetTemplatesAction action = new HttpGetTemplatesAction(activity);
+                HttpGetTemplatesAction action = new HttpGetTemplatesAction(ability);
                 action.postExecute(action.execute().get());
                 if (action.getException() != null) {
                     templates = new ArrayList<InstanceConfig>();
@@ -988,37 +943,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
 
 
-        if (domain != null) {
-//            setTitle(Utils.stripTags(domain.name));
-            HttpGetImageAction.fetchImage(this, domain.avatar, null); //-----------------
-//            HttpGetImageAction.fetchImage(this, domain.avatar, (Image) findComponentById(ResourceTable.Id_splash));
-        }
-
-        if (MainAbility.user == null) {
-//            findComponentById(ResourceTable.Id_viewUserButton).setVisibility(HIDE);
-            //findViewById(R.id.logoutButton).setVisibility(View.GONE);
-            //findViewById(R.id.loginButton).setVisibility(View.VISIBLE);
-        } else {
-            //findViewById(R.id.logoutButton).setVisibility(View.VISIBLE);
-            //findViewById(R.id.loginButton).setVisibility(View.GONE);
-//            findComponentById(ResourceTable.Id_viewUserButton).setVisibility(VISIBLE);
-            //HttpGetImageAction.fetchImage(this, MainActivity.user.avatar, findViewById(R.id.viewUserButton));
-        }
         resetMenu(this.menu);
         resetLast();
     }
 
     public void resetLast() {
-//        String type = MainAbility.defaultType;
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);  // 需要放入 adapter中做判断
-//        if (spin != null) {
-//            type = (String) spin.getSelectedItem();
-//            if (type.equals("Chat Bot Wars")) {
-//                spin.setSelection(0);
-//                war(null);
-//                return;
-//            }
-//        }
+
         if (type.equals("Chat Bot Wars")) {
             war();
             return;
@@ -1211,8 +1141,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         editor.delete("deviceVoice");
         editor.flushSync();
 
-        HttpGetImageAction.clearFileCache(this);
-
         Intent intent = getIntent();
         terminateAbility();
         startAbility(intent);
@@ -1329,25 +1257,12 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     public void createUser() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//
-//        Intent intent = new Intent(this, CreateUserActivity.class);
-//        startActivity(intent);
+
         startOpenAbility(this, CreateUserAbility.class.getName());
     }
 
     public void editUser() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//
-//        Intent intent = new Intent(this, EditUserActivity.class);
-//        startActivity(intent);
-//        startOpenAbility(this, EditUserAbility.class.getName()); //================
+
     }
 
     public static void setOnline(boolean result){
@@ -1360,24 +1275,13 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
     }
 
     public void help() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
-//        super.help(view);
+
         startOpenAbility(this, HelpAbility.class.getName());
     }
 
     public void viewUser() {
         viewUser = user;
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
 
-//        Intent intent = new Intent(this, ViewUserActivity.class);
-//        startActivity(intent);
-//        startOpenAbility(this, ViewUserAbility.class.getName()); //================
     }
 
     public void openWebsite() {
@@ -1398,89 +1302,24 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
             showLogin("","You must sign in first",this);
             return;
         }
-//        Spinner spin = (Spinner) findViewById(getResources().getIdentifier("typeSpin", "id", getPackageName()));
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
         if (type.equals("Bots")) {
             MainAbility.template = "";
-//            Intent intent = new Intent(this, CreateBotActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateBotAbility.class.getName()); //================
-        } else if (type.equals("Forums")) {
-//            Intent intent = new Intent(this, CreateForumActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateForumAbility.class.getName()); //================
-        } else if (type.equals("Live Chat")) {
-//            Intent intent = new Intent(this, CreateChannelActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateChannelAbility.class.getName()); //================
-        } else if (type.equals("Domains")) {
-//            Intent intent = new Intent(this, CreateDomainActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateDomainAbility.class.getName()); //================
-        } else if (type.equals("Avatars")) {
-//            Intent intent = new Intent(this, CreateAvatarActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateAvatarAbility.class.getName()); //================
-        } else if (type.equals("Scripts")) {
-//            Intent intent = new Intent(this, CreateScriptActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateScriptAbility.class.getName()); //================
-        } else if (type.equals("Graphics")) {
-//            Intent intent = new Intent(this, CreateGraphicActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, CreateGraphicAbility.class.getName()); //================
         }
     }
 
     public void search() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
         if (type.equals("Bots")) {
-//            Intent intent = new Intent(this, BotSearchActivity.class);
-//            startActivity(intent);
             startOpenAbility(this, BotSearchAbility.class.getName());
-        } else if (type.equals("Forums")) {
-//            Intent intent = new Intent(this, ForumSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ForumSearchAbility.class.getName()); //================
-        } else if (type.equals("Live Chat")) {
-//            Intent intent = new Intent(this, ChannelSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ChannelSearchAbility.class.getName()); //================
-        } else if (type.equals("Domains")) {
-//            Intent intent = new Intent(this, DomainSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, DomainSearchAbility.class.getName()); //================
-        } else if (type.equals("Avatars")) {
-//            Intent intent = new Intent(this, AvatarSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, AvatarSearchAbility.class.getName()); //================
-        } else if (type.equals("Scripts")) {
-//            Intent intent = new Intent(this, ScriptSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, ScriptSearchAbility.class.getName()); //================
-        } else if (type.equals("Graphics")) {
-//            Intent intent = new Intent(this, GraphicSearchActivity.class);
-//            startActivity(intent);
-//            startOpenAbility(this, GraphicSearchAbility.class.getName()); //================
         }
     }
 
     public void browseMyBots() {
-//        Spinner spin = (Spinner) findViewById(R.id.typeSpin);
-//        if (spin != null) {
-//            type = (String)spin.getSelectedItem();
-//        }
         if (type == null) {
             type = MainAbility.defaultType;
         }
@@ -1612,29 +1451,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
 //        action.execute();
     }
 
-    /**
-     * Start a chat session with the user's personal instance.
-     */
-    public void launchMyBot(View view) {
-        if (user == null) {
-            CommonDialog dialog = new CommonDialog(this);
-            dialog.setContentText("You must sign in first");
-            dialog.setButton(1, "OK", new IDialog.ClickedListener() {
-                @Override
-                public void onClick(IDialog iDialog, int i) {
-                    login();
-                }
-            });
-            dialog.show();
-            return;
-        }
-        WebMediumConfig config = new InstanceConfig();
-        config.name = "Bot " + MainAbility.user.user;
-
-        HttpFetchOrCreateAction action = new HttpFetchOrCreateAction(this, config, true);
-//        action.execute();
-    }
-
     public static String selectInfo = "";
     Text languageselect;
     @SuppressWarnings({ "rawtypes", "unchecked" })
@@ -1720,9 +1536,6 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
                     cookies.putString("nativeVoice", String.valueOf(MainAbility.voice.nativeVoice));
                     cookies.flushSync();
                 }
-//                if (listener != null) {
-//                    listener.onClick(dialog, i);
-//                }
                 dialog.destroy();
             }
         });
@@ -1734,20 +1547,4 @@ public class MainAbility extends LibreAbility implements SelectListener, Languag
         });
     }
 
-    public static void readZipAvatars(Ability activity, String fileName) {
-        // this is only for letting Julie Assistance Avatar works, since there
-        // is only one file called
-        // "Julie" I will have to take this name and read the file from the
-        // method @readZipAvatars.
-        String args[] = fileName.split("\\s+");
-        // ex: Julie = Julie
-        // Julie Assistant = Julie
-        // Its only going to take one name
-        try {
-//            GetAvatarAction avatar = new GetAvatarAction(activity);
-//            avatar.readZipFile(args[0] + ".zip");
-//            MicroConnection.avatarConfig = avatar.instance;
-        } catch (Exception ignore) {
-        }
-    }
 }
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/SDKConnection.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
index 7dc7f7db821aa55b62b05a2cb1fc139543ab927e..f1bd489bc4d1c2c0e2764b8b70224e269ad32af5 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/SDKConnection.java
@@ -31,6 +31,7 @@ import com.franmontiel.persistentcookiejar.ClearableCookieJar;
 import com.franmontiel.persistentcookiejar.PersistentCookieJar;
 import com.franmontiel.persistentcookiejar.cache.SetCookieCache;
 import com.franmontiel.persistentcookiejar.persistence.SharedPrefsCookiePersistor;
+import ohos.agp.components.element.ShapeElement;
 import org.botlibre.sdk.config.AvatarConfig;
 import org.botlibre.sdk.config.AvatarMedia;
 import org.botlibre.sdk.config.AvatarMessage;
@@ -124,6 +125,8 @@ public class SDKConnection {
 
 	/**
 	 * Return the name of the default user image.
+	 *
+	 * @return default user image
 	 */
 	public static String defaultUserImage() {
 		return "images/user-thumb.jpg";
@@ -138,6 +141,8 @@ public class SDKConnection {
 	/**
 	 * Create an SDK connection with the credentials.
 	 * Use the Credentials subclass specific to your server.
+	 *
+	 * @param credentials Credentials
 	 */
 	public SDKConnection(Credentials credentials) {
 		this.credentials = credentials;
@@ -149,6 +154,9 @@ public class SDKConnection {
 	 * The user details are returned (with a connection token, password removed).
 	 * The user credentials are soted in the connection, and used on subsequent calls.
 	 * An SDKException is thrown if the connect failed.
+	 *
+	 * @param config UserConfig
+	 * @return UserConfig
 	 */
 	public UserConfig connect(UserConfig config) {
 		config.addCredentials(this);
@@ -171,6 +179,10 @@ public class SDKConnection {
 	
 	/**
 	 * Execute the custom API.
+	 *
+	 * @param config
+	 * @param api
+	 * @param result
 	 */
 	public Config custom(String api, Config config, Config result) {
 		config.addCredentials(this);
@@ -187,23 +199,14 @@ public class SDKConnection {
 		}
 		return result;
 	}
-	
-	/**
-	 * Connect to the live chat channel and return a LiveChatConnection.
-	 * A LiveChatConnection is separate from an SDKConnection and uses web sockets for
-	 * asynchronous communication.
-	 * The listener will be notified of all messages.
-	 */
-	public LiveChatConnection openLiveChat(ChannelConfig channel, LiveChatListener listener) {
-		LiveChatConnection connection = new LiveChatConnection(this.credentials, listener);
-		connection.connect(channel, this.user);
-		return connection;
-	}
-	
+
 	/**
 	 * Connect to the domain.
 	 * A domain is an isolated content space.
 	 * Any browse or query request will be specific to the domain's content.
+	 *
+	 * @param config DomainConfig
+	 * @return DomainConfig
 	 */	
 	public DomainConfig connect(DomainConfig config) {
 		this.domain = fetch(config);
@@ -221,6 +224,9 @@ public class SDKConnection {
 	
 	/**
 	 * Fetch the user details.
+	 *
+	 * @param config UserConfig
+	 * @return UserConfig
 	 */	
 	public UserConfig fetch(UserConfig config) {
 		config.addCredentials(this);
@@ -241,6 +247,9 @@ public class SDKConnection {
 	
 	/**
 	 * Fetch the URL for the image from the server.
+	 *
+	 * @param image String
+	 * @return URL
 	 */	
 	public URL fetchImage(String image) {
 		try {
@@ -253,6 +262,9 @@ public class SDKConnection {
 	
 	/**
 	 * Fetch the forum post details for the forum post id.
+	 *
+	 * @param config ForumPostConfig
+	 * @return ForumPostConfig
 	 */	
 	public ForumPostConfig fetch(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -273,6 +285,9 @@ public class SDKConnection {
 
 	/**
 	 * Fetch the issue details for the issue id.
+	 *
+	 * @param config IssueConfig
+	 * @return IssueConfig
 	 */
 	public IssueConfig fetch(IssueConfig config) {
 		config.addCredentials(this);
@@ -293,6 +308,10 @@ public class SDKConnection {
 	
 	/**
 	 * Create a new user.
+	 *
+	 * @param config UserConfig
+	 * @param ability Ability
+	 * @return UserConfig
 	 */
 	public UserConfig create(Ability ability,UserConfig config) {
 		config.addCredentials(this);
@@ -315,6 +334,9 @@ public class SDKConnection {
 	/**
 	 * Create a new forum post.
 	 * You must set the forum id for the post.
+	 *
+	 * @param config ForumPostConfig
+	 * @return ForumPostConfig
 	 */
 	public ForumPostConfig create(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -336,6 +358,9 @@ public class SDKConnection {
 	/**
 	 * Create a new issue.
 	 * You must set the issue tracker id for the issue.
+	 *
+	 * @param config IssueConfig
+	 * @return IssueConfig
 	 */
 	public IssueConfig create(IssueConfig config) {
 		config.addCredentials(this);
@@ -356,6 +381,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new file/image/media attachment for a chat channel.
+	 *
+	 * @param config MediaConfig
+	 * @param file String
+	 * @return MediaConfig
 	 */
 	public MediaConfig createChannelFileAttachment(String file, MediaConfig config) {
 		config.addCredentials(this);
@@ -376,6 +405,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new image attachment for a chat channel.
+	 *
+	 * @param file String
+	 * @param config MediaConfig
+	 * @return MediaConfig
 	 */
 	public MediaConfig createChannelImageAttachment(String file, MediaConfig config) {
 		config.addCredentials(this);
@@ -396,6 +429,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new file/image/media attachment for an issue tracker.
+	 *
+	 * @param config MediaConfig
+	 * @param file String
+	 * @return MediaConfig
 	 */
 	public MediaConfig createIssueTrackerFileAttachment(String file, MediaConfig config) {
 		config.addCredentials(this);
@@ -416,6 +453,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new image attachment for an issue tracker.
+	 *
+	 * @param file String
+	 * @param config MediaConfig
+	 * @return MediaConfig
 	 */
 	public MediaConfig createIssueTrackerImageAttachment(String file, MediaConfig config) {
 		config.addCredentials(this);
@@ -436,6 +477,10 @@ public class SDKConnection {
 
 	/**
 	 * Create a new image attachment for an issue tracker.
+	 *
+	 * @param config MediaConfig
+	 * @param bitmap PixelMap
+	 * @return MediaConfig
 	 */
 	public MediaConfig createIssueTrackerImageAttachment(PixelMap bitmap, MediaConfig config) {
 		config.addCredentials(this);
@@ -457,6 +502,9 @@ public class SDKConnection {
 	/**
 	 * Create a reply to a forum post.
 	 * You must set the parent id for the post replying to.
+	 *
+	 * @param config ForumPostConfig
+	 * @return ForumPostConfig
 	 */
 	public ForumPostConfig createReply(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -479,6 +527,8 @@ public class SDKConnection {
 	 * Create a user message.
 	 * This can be used to send a user a direct message.
 	 * SPAM will cause your account to be deleted.
+	 *
+	 * @param config UserMessageConfig
 	 */
 	public void createUserMessage(UserMessageConfig config) {
 		config.addCredentials(this);
@@ -488,6 +538,9 @@ public class SDKConnection {
 	/**
 	 * Fetch the content details from the server.
 	 * The id or name and domain of the object must be set.
+	 *
+	 * @param config config
+	 * @return WebMediumConfig
 	 */
 	@SuppressWarnings("unchecked")
 	public <T extends WebMediumConfig> T fetch(T config) {
@@ -510,6 +563,9 @@ public class SDKConnection {
 	/**
 	 * Create the new content.
 	 * The content will be returned with its new id.
+	 *
+	 * @param config config
+	 * @return WebMediumConfig
 	 */
 	@SuppressWarnings("unchecked")
 	public <T extends WebMediumConfig> T create(T config) {
@@ -531,6 +587,9 @@ public class SDKConnection {
 	
 	/**
 	 * Update the content.
+	 *
+	 * @param config config
+	 * @return WebMediumConfig
 	 */
 	@SuppressWarnings("unchecked")
 	public <T extends WebMediumConfig> T update(T config) {
@@ -552,6 +611,9 @@ public class SDKConnection {
 	
 	/**
 	 * Update the forum post.
+	 *
+	 * @param config ForumPostConfig
+	 * @return ForumPostConfig
 	 */
 	public ForumPostConfig update(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -572,6 +634,9 @@ public class SDKConnection {
 
 	/**
 	 * Update the issue.
+	 *
+	 * @param config IssueConfig
+	 * @return IssueConfig
 	 */
 	public IssueConfig update(IssueConfig config) {
 		config.addCredentials(this);
@@ -593,6 +658,9 @@ public class SDKConnection {
 	/**
 	 * Create or update the response.
 	 * This can also be used to flag, unflag, validate, or invalidate a response.
+	 *
+	 * @param config ResponseConfig
+	 * @return ResponseConfig
 	 */
 	public ResponseConfig saveResponse(ResponseConfig config) {
 		config.addCredentials(this);
@@ -614,6 +682,9 @@ public class SDKConnection {
 	/**
 	 * Update the user details.
 	 * The password must be passed to allow the update.
+	 *
+	 * @param config UserConfig
+	 * @return UserConfig
 	 */
 	public UserConfig update(UserConfig config) {
 		config.addCredentials(this);
@@ -635,6 +706,8 @@ public class SDKConnection {
 	
 	/**
 	 * Permanently delete the content with the id.
+	 *
+	 * @param config WebMediumConfig
 	 */
 	public void delete(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -646,6 +719,8 @@ public class SDKConnection {
 	
 	/**
 	 * Permanently delete the forum post with the id.
+	 *
+	 * @param config ForumPostConfig
 	 */
 	public void delete(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -654,6 +729,8 @@ public class SDKConnection {
 
 	/**
 	 * Permanently delete the issue with the id.
+	 *
+	 * @param config IssueConfig
 	 */
 	public void delete(IssueConfig config) {
 		config.addCredentials(this);
@@ -662,6 +739,8 @@ public class SDKConnection {
 	
 	/**
 	 * Permanently delete the response, greetings, or default response with the response id (and question id).
+	 *
+	 * @param config ResponseConfig
 	 */
 	public void delete(ResponseConfig config) {
 		config.addCredentials(this);
@@ -670,6 +749,8 @@ public class SDKConnection {
 	
 	/**
 	 * Permanently delete the avatar media.
+	 *
+	 * @param config AvatarMedia
 	 */
 	public void delete(AvatarMedia config) {
 		config.addCredentials(this);
@@ -678,6 +759,8 @@ public class SDKConnection {
 	
 	/**
 	 * Permanently delete the avatar background.
+	 *
+	 * @param config AvatarConfig
 	 */
 	public void deleteAvatarBackground(AvatarConfig config) {
 		config.addCredentials(this);
@@ -686,6 +769,8 @@ public class SDKConnection {
 	
 	/**
 	 * Save the avatar media tags.
+	 *
+	 * @param config AvatarMedia
 	 */
 	public void saveAvatarMedia(AvatarMedia config) {
 		config.addCredentials(this);
@@ -694,6 +779,8 @@ public class SDKConnection {
 	
 	/**
 	 * Flag the content as offensive, a reason is required.
+	 *
+	 * @param config WebMediumConfig
 	 */
 	public void flag(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -702,6 +789,8 @@ public class SDKConnection {
 	
 	/**
 	 * Subscribe for email updates for the post.
+	 *
+	 * @param config ForumPostConfig
 	 */
 	public void subscribe(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -710,6 +799,8 @@ public class SDKConnection {
 
 	/**
 	 * Subscribe for email updates for the issue.
+	 *
+	 * @param config IssueConfig
 	 */
 	public void subscribe(IssueConfig config) {
 		config.addCredentials(this);
@@ -718,6 +809,8 @@ public class SDKConnection {
 	
 	/**
 	 * Subscribe for email updates for the forum.
+	 *
+	 * @param config ForumConfig
 	 */
 	public void subscribe(ForumConfig config) {
 		config.addCredentials(this);
@@ -726,6 +819,8 @@ public class SDKConnection {
 	
 	/**
 	 * Unsubscribe from email updates for the post.
+	 *
+	 * @param config ForumPostConfig
 	 */
 	public void unsubscribe(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -734,6 +829,8 @@ public class SDKConnection {
 
 	/**
 	 * Unsubscribe from email updates for the issue.
+	 *
+	 * @param config IssueConfig
 	 */
 	public void unsubscribe(IssueConfig config) {
 		config.addCredentials(this);
@@ -742,6 +839,8 @@ public class SDKConnection {
 	
 	/**
 	 * Unsubscribe from email updates for the forum.
+	 *
+	 * @param config ForumConfig
 	 */
 	public void unsubscribe(ForumConfig config) {
 		config.addCredentials(this);
@@ -750,6 +849,8 @@ public class SDKConnection {
 	
 	/**
 	 * Thumbs up the content.
+	 *
+	 * @param config WebMediumConfig
 	 */
 	public void thumbsUp(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -758,6 +859,8 @@ public class SDKConnection {
 	
 	/**
 	 * Thumbs down the content.
+	 *
+	 * @param config WebMediumConfig
 	 */
 	public void thumbsDown(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -766,6 +869,8 @@ public class SDKConnection {
 	
 	/**
 	 * Rate the content.
+	 *
+	 * @param config WebMediumConfig
 	 */
 	public void star(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -774,6 +879,8 @@ public class SDKConnection {
 	
 	/**
 	 * Thumbs up the content.
+	 *
+	 * @param config ForumPostConfig
 	 */
 	public void thumbsUp(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -782,6 +889,8 @@ public class SDKConnection {
 	
 	/**
 	 * Thumbs down the content.
+	 *
+	 * @param config ForumPostConfig
 	 */
 	public void thumbsDown(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -790,6 +899,8 @@ public class SDKConnection {
 	
 	/**
 	 * Rate the content.
+	 *
+	 * @param config ForumPostConfig
 	 */
 	public void star(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -798,6 +909,8 @@ public class SDKConnection {
 	
 	/**
 	 * Flag the forum post as offensive, a reason is required.
+	 *
+	 * @param config ForumPostConfig
 	 */
 	public void flag(ForumPostConfig config) {
 		config.addCredentials(this);
@@ -806,6 +919,8 @@ public class SDKConnection {
 
 	/**
 	 * Thumbs up the content.
+	 *
+	 * @param config IssueConfig
 	 */
 	public void thumbsUp(IssueConfig config) {
 		config.addCredentials(this);
@@ -814,6 +929,8 @@ public class SDKConnection {
 
 	/**
 	 * Thumbs down the content.
+	 *
+	 * @param config IssueConfig
 	 */
 	public void thumbsDown(IssueConfig config) {
 		config.addCredentials(this);
@@ -822,6 +939,8 @@ public class SDKConnection {
 
 	/**
 	 * Rate the content.
+	 *
+	 * @param config IssueConfig
 	 */
 	public void star(IssueConfig config) {
 		config.addCredentials(this);
@@ -830,6 +949,8 @@ public class SDKConnection {
 
 	/**
 	 * Flag the forum post as offensive, a reason is required.
+	 *
+	 * @param config IssueConfig
 	 */
 	public void flag(IssueConfig config) {
 		config.addCredentials(this);
@@ -838,6 +959,8 @@ public class SDKConnection {
 	
 	/**
 	 * Flag the user post as offensive, a reason is required.
+	 *
+	 * @param config UserConfig
 	 */
 	public void flag(UserConfig config) {
 		config.addCredentials(this);
@@ -847,7 +970,10 @@ public class SDKConnection {
 	/**
 	 * Process the bot chat message and return the bot's response.
 	 * The ChatConfig should contain the conversation id if part of a conversation.
-	 * If a new conversation the conversation id is returned in the response. 
+	 * If a new conversation the conversation id is returned in the response.
+	 *
+	 * @param config ChatConfig
+	 * @return ChatResponse
 	 */
 	public ChatResponse chat(ChatConfig config) {
 		config.addCredentials(this);
@@ -869,6 +995,9 @@ public class SDKConnection {
 	/**
 	 * Process the avatar message and return the avatars response.
 	 * This allows the speech and video animation for an avatar to be generated for the message.
+	 *
+	 * @param config AvatarMessage
+	 * @return ChatResponse
 	 */
 	public ChatResponse avatarMessage(AvatarMessage config) {
 		config.addCredentials(this);
@@ -890,6 +1019,9 @@ public class SDKConnection {
 	/**
 	 * Process the speech message and return the server generate text-to-speech audio file.
 	 * This allows for server-side speech generation.
+	 *
+	 * @param config Speech
+	 * @return String
 	 */
 	public String tts(Speech config) {
 		config.addCredentials(this);
@@ -898,6 +1030,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the administrators of the content.
+	 *
+	 * @param config WebMediumConfig
+	 * @return List
 	 */
 	public List<String> getAdmins(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -917,6 +1052,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the list of user details for the comma separated values list of user ids.
+	 *
+	 * @param usersCSV String
+	 * @return list of user ids
 	 */
 	public List<UserConfig> getUsers(String usersCSV) {
 		UserConfig config = new UserConfig();
@@ -939,6 +1077,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the list of forum posts for the forum browse criteria.
+	 *
+	 * @param config BrowseConfig
+	 * @return list of forum posts for the forum browse criteria
 	 */
 	public List<ForumPostConfig> getPosts(BrowseConfig config) {
 		config.addCredentials(this);
@@ -958,6 +1099,9 @@ public class SDKConnection {
 
 	/**
 	 * Return the list of issues for the issue tracker browse criteria.
+	 *
+	 * @param config BrowseConfig
+	 * @return list of issues for the issue tracker browse criteria
 	 */
 	public List<IssueConfig> getIssues(BrowseConfig config) {
 		config.addCredentials(this);
@@ -977,6 +1121,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the list of categories for the type, and domain.
+	 *
+	 * @param config ContentConfig
+	 * @return list of categories for the type, and domain
 	 */
 	public List<ContentConfig> getCategories(ContentConfig config) {
 		config.addCredentials(this);
@@ -996,6 +1143,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the list of tags for the type, and domain.
+	 *
+	 * @param config ContentConfig
+	 * @return list of tags for the type, and domain
 	 */
 	public List<String> getTags(ContentConfig config) {
 		config.addCredentials(this);
@@ -1014,9 +1164,9 @@ public class SDKConnection {
 	
 	/**
 	  * Return the list of bot templates.
+	 *
+	 * @return list of bot templates
 	  */
-	
-	//return the list of templates with the pictures.
 	 public List<InstanceConfig> getTemplates() {
 	  String xml = GET(this.url + "/get-all-templates");
 	  List<InstanceConfig> instances = new ArrayList<InstanceConfig>();
@@ -1034,6 +1184,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the users for the content.
+	 *
+	 * @param config WebMediumConfig
+	 * @return users for the content
 	 */
 	public List<String> getUsers(WebMediumConfig config) {
 		config.addCredentials(this);
@@ -1053,6 +1206,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the channel's bot configuration.
+	 *
+	 * @param config ChannelConfig
+	 * @return channel's bot configuration
 	 */
 	public BotModeConfig getChannelBotMode(ChannelConfig config) {
 		config.addCredentials(this);
@@ -1073,6 +1229,8 @@ public class SDKConnection {
 	
 	/**
 	 * Save the channel's bot configuration.
+	 *
+	 * @param config BotModeConfig
 	 */
 	public void saveChannelBotMode(BotModeConfig config) {
 		config.addCredentials(this);
@@ -1081,6 +1239,8 @@ public class SDKConnection {
 	
 	/**
 	 * Save the forum's bot configuration.
+	 *
+	 * @param config BotModeConfig
 	 */
 	public void saveForumBotMode(BotModeConfig config) {
 		config.addCredentials(this);
@@ -1089,6 +1249,8 @@ public class SDKConnection {
 	
 	/**
 	 * Save the bot's learning configuration.
+	 *
+	 * @param config LearningConfig
 	 */
 	public void saveLearning(LearningConfig config) {
 		config.addCredentials(this);
@@ -1097,6 +1259,8 @@ public class SDKConnection {
 	
 	/**
 	 * Save the bot's voice configuration.
+	 *
+	 * @param config VoiceConfig
 	 */
 	public void saveVoice(VoiceConfig config) {
 		config.addCredentials(this);
@@ -1105,22 +1269,18 @@ public class SDKConnection {
 	
 	/**
 	 * Save the bot's avatar configuration.
+	 *
+	 * @param config InstanceConfig
 	 */
 	public void saveBotAvatar(InstanceConfig config) {
 		config.addCredentials(this);
 		POST(this.url + "/save-bot-avatar", config.toXML());
 	}
-	
-	/**
-	 * Train the bot with a new question/response pair.
-	 */
-	public void train(TrainingConfig config) {
-		config.addCredentials(this);
-		POST(this.url + "/train-instance", config.toXML());
-	}
-	
+
 	/**
 	 * Perform the user administration task (add or remove users, or administrators).
+	 *
+	 * @param config UserAdminConfig
 	 */
 	public void userAdmin(UserAdminConfig config) {
 		config.addCredentials(this);
@@ -1129,6 +1289,9 @@ public class SDKConnection {
 	
 	/**
 	 * Save the image as the avatar's background.
+	 *
+	 * @param config AvatarMedia
+	 * @param file String
 	 */
 	public void saveAvatarBackground(String file, AvatarMedia config) {
 		config.addCredentials(this);
@@ -1137,6 +1300,9 @@ public class SDKConnection {
 	
 	/**
 	 * Add the avatar media file to the avatar.
+	 *
+	 * @param config AvatarMedia
+	 * @param file String
 	 */
 	public void createAvatarMedia(String file, AvatarMedia config) {
 		config.addCredentials(this);
@@ -1152,6 +1318,9 @@ public class SDKConnection {
 	}
 	/**
 	 * Add the graphic media file to the graphic.
+	 *
+	 * @param config GraphicConfig
+	 * @param file String
 	 */
 	public void createGraphicMedia(String file, GraphicConfig config) {
 		config.addCredentials(this);
@@ -1164,6 +1333,10 @@ public class SDKConnection {
 	/**
 	 * Update the contents icon.
 	 * The file will be uploaded to the server.
+	 *
+	 * @param config config
+	 * @param file String
+	 * @return WebMediumConfig
 	 */
 	@SuppressWarnings("unchecked")
 	public <T extends WebMediumConfig> T updateIcon(String file, T config) {
@@ -1186,6 +1359,10 @@ public class SDKConnection {
 	/**
 	 * Update the user's icon.
 	 * The file will be uploaded to the server.
+	 *
+	 * @param file String
+	 * @param config UserConfig
+	 * @return UserConfig
 	 */
 	public UserConfig updateIcon(String file, UserConfig config) {
 		config.addCredentials(this);
@@ -1203,7 +1380,16 @@ public class SDKConnection {
 			throw this.exception;
 		}
 	}
-	
+
+	/**
+	 * POSTIMAGE
+	 *
+	 * @param file String
+	 * @param url String
+	 * @param name String
+	 * @param xml String
+	 * @return String
+	 * */
 	public String POSTIMAGE(String url, String file, String name, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1211,44 +1397,18 @@ public class SDKConnection {
 			System.out.println("XML: " + xml);
 		}
 		String result = "";
-//		try { //=====================
-//			Bitmap bitmap = loadImage(file, 600, 600);
-//	        ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//	        bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream);
-//	        byte[] byte_arr = stream.toByteArray();
-//	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-//
-//	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-//
-//	        multipartEntity.addPart("file", fileBody);
-//	        multipartEntity.addPart("xml", new StringBody(xml));
-//
-//	        HttpClient httpclient = new DefaultHttpClient();
-//	        HttpResponse response = null;
-//
-//            HttpPost httppost = new HttpPost(url);
-//            httppost.setEntity(multipartEntity);
-//            response = httpclient.execute(httppost);
-//
-//			HttpEntity entity = response.getEntity();
-//			if (entity != null) {
-//				result = EntityUtils.toString(entity, HTTP.UTF_8);
-//			}
-//
-//			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-//				this.exception = new SDKException(""
-//				   + response.getStatusLine().getStatusCode()
-//				   + " : " + result);
-//	 			throw this.exception;
-//			}
-//
-//        } catch (Exception exception) {
-// 			this.exception = new SDKException(exception);
-// 			throw this.exception;
-// 		}
  		return result;
 	}
 
+	/**
+	 * POSTIMAGE
+	 *
+	 * @param xml String
+	 * @param name String
+	 * @param url String
+	 * @param bitmap PixelMap
+	 * @return String
+	 * */
 	public String POSTIMAGE(String url, PixelMap bitmap, String name, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1257,7 +1417,6 @@ public class SDKConnection {
 		String result = "";
 		try {
 			ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//			bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream); //=====================
 			byte[] byte_arr = stream.toByteArray();
 			ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
 
@@ -1291,7 +1450,16 @@ public class SDKConnection {
 		}
 		return result;
 	}
-	
+
+	/**
+	 * POSTHDIMAGE
+	 *
+	 * @param url String
+	 * @param name String
+	 * @param xml String
+	 * @param file String
+	 * @return String
+	 * */
 	public String POSTHDIMAGE(String url, String file, String name, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1300,43 +1468,22 @@ public class SDKConnection {
 		}
 		String result = "";
 		try {
-//			Bitmap bitmap = loadImage(file, 600, 600);  //=====================
-//	        ByteArrayOutputStream stream = new ByteArrayOutputStream();
-//	        bitmap.compress(Bitmap.CompressFormat.JPEG, 90, stream);
-//	        byte[] byte_arr = stream.toByteArray();
-//	        ByteArrayBody fileBody = new ByteArrayBody(byte_arr, name);
-//
-//	        MultipartEntity multipartEntity = new MultipartEntity(HttpMultipartMode.BROWSER_COMPATIBLE);
-//
-//	        multipartEntity.addPart("file", fileBody);
-//	        multipartEntity.addPart("xml", new StringBody(xml));
-//
-//	        HttpClient httpclient = new DefaultHttpClient();
-//	        HttpResponse response = null;
-//
-//            HttpPost httppost = new HttpPost(url);
-//            httppost.setEntity(multipartEntity);
-//            response = httpclient.execute(httppost);
-//
-//			HttpEntity entity = response.getEntity();
-//			if (entity != null) {
-//				result = EntityUtils.toString(entity, HTTP.UTF_8);
-//			}
-//
-//			if ((response.getStatusLine().getStatusCode() != 200) && (response.getStatusLine().getStatusCode() != 204)) {
-//				this.exception = new SDKException(""
-//				   + response.getStatusLine().getStatusCode()
-//				   + " : " + result);
-//	 			throw this.exception;
-//			}
-
         } catch (Exception exception) {
  			this.exception = new SDKException(exception);
  			throw this.exception;
  		}
  		return result;
 	}
-	
+
+	/**
+	 * POSTFILE
+	 *
+	 * @param xml String
+	 * @param name String
+	 * @param url String
+	 * @param path String
+	 * @return String
+	 * */
 	public String POSTFILE(String url, String path, String name, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1388,35 +1535,11 @@ public class SDKConnection {
  		return result;
 	}
 
-	public PixelMap loadImage(String path, int reqWidth, int reqHeight) {
-//	    BitmapFactory.Options options = new BitmapFactory.Options(); //=====================
-//	    options.inJustDecodeBounds = true;
-//	    BitmapFactory.decodeFile(path, options);
-//
-//        int height = options.outHeight;
-//        int width = options.outWidth;
-//        options.inPreferredConfig = Bitmap.Config.RGB_565;
-//        int inSampleSize = 1;
-//
-//        if (height > reqHeight) {
-//            inSampleSize = Math.round((float)height / (float)reqHeight);
-//        }
-//
-//        int expectedWidth = width / inSampleSize;
-//
-//        if (expectedWidth > reqWidth) {
-//            inSampleSize = Math.round((float)width / (float)reqWidth);
-//        }
-//
-//	    options.inSampleSize = inSampleSize;
-//	    options.inJustDecodeBounds = false;
-//
-//	    return BitmapFactory.decodeFile(path, options);
-		return null;
-	 }
-	
 	/**
 	 * Return the forum's bot configuration.
+	 *
+	 * @param config ForumConfig
+	 * @return BotModeConfig
 	 */
 	public BotModeConfig getForumBotMode(ForumConfig config) {
 		config.addCredentials(this);
@@ -1437,6 +1560,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the bot's voice configuration.
+	 *
+	 * @param config InstanceConfig
+	 * @return VoiceConfig
 	 */
 	public VoiceConfig getVoice(InstanceConfig config) {
 		config.addCredentials(this);
@@ -1457,6 +1583,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the bot's default responses.
+	 *
+	 * @param config InstanceConfig
+	 * @return bot's default responses
 	 */
 	public List<String> getDefaultResponses(InstanceConfig config) {
 		config.addCredentials(this);
@@ -1471,26 +1600,12 @@ public class SDKConnection {
 		}
 		return defaultResponses;
 	}
-	
-	/**
-	 * Return the bot's greetings.
-	 */
-	public List<String> getGreetings(InstanceConfig config) {
-		config.addCredentials(this);
-		String xml = POST(this.url + "/get-greetings", config.toXML());
-		List<String> greetings = new ArrayList<String>();
-		Element root = parse(xml);
-		if (root == null) {
-			return greetings;
-		}
-		for (int index = 0; index < root.getChildNodes().getLength(); index++) {
-			greetings.add(((Element)root.getChildNodes().item(index)).getChildNodes().item(0).getTextContent());
-		}
-		return greetings;
-	}
-	
+
 	/**
 	 * Search the bot's responses.
+	 *
+	 * @param config ResponseSearchConfig
+	 * @return bot's responses
 	 */
 	public List<ResponseConfig> getResponses(ResponseSearchConfig config) {
 		config.addCredentials(this);
@@ -1510,6 +1625,9 @@ public class SDKConnection {
 	
 	/**
 	 * Search the bot's conversations.
+	 *
+	 * @param config ResponseSearchConfig
+	 * @return bot's conversations
 	 */
 	public List<ConversationConfig> getConversations(ResponseSearchConfig config) {
 		config.addCredentials(this);
@@ -1529,6 +1647,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the bot's learning configuration.
+	 *
+	 * @param config InstanceConfig
+	 * @return bot's learning configuration
 	 */
 	public LearningConfig getLearning(InstanceConfig config) {
 		config.addCredentials(this);
@@ -1550,6 +1671,10 @@ public class SDKConnection {
 	/**
 	 * Return the list of content for the browse criteria.
 	 * The type defines the content type (one of Bot, Forum, Channel, Domain).
+	 *
+	 * @param config BrowseConfig
+	 * @param ability Ability
+	 * @return list of content for the browse criteria
 	 */
 	public List<WebMediumConfig> browse(Ability ability,BrowseConfig config) {
 		config.addCredentials(this);
@@ -1590,6 +1715,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the list of media for the avatar.
+	 *
+	 * @param config AvatarConfig
+	 * @return list of media for the avatar
 	 */
 	public List<AvatarMedia> getAvatarMedia(AvatarConfig config) {
 		config.addCredentials(this);
@@ -1609,6 +1737,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the script source
+	 *
+	 * @param config ScriptConfig
+	 * @return script source
 	 */
 	public ScriptSourceConfig getScriptSource(ScriptConfig config) {
 		config.addCredentials(this);
@@ -1629,6 +1760,8 @@ public class SDKConnection {
 	
 	/**
 	 * Create or update script - Save the script source
+	 *
+	 * @param config ScriptSourceConfig
 	 */
 	public void saveScriptSource(ScriptSourceConfig config) {
 		config.addCredentials(this);
@@ -1637,6 +1770,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return the source code for a single bot script
+	 *
+	 * @param config ScriptSourceConfig
+	 * @return ScriptSourceConfig
 	 */
 	public ScriptSourceConfig getBotScriptSource(ScriptSourceConfig config) {
 		config.addCredentials(this);
@@ -1657,6 +1793,9 @@ public class SDKConnection {
 	
 	/**
 	 * Return a list of the bots scripts
+	 *
+	 * @param config InstanceConfig
+	 * @return list of the bots scripts
 	 */
 	public List<ScriptConfig> getBotScripts(InstanceConfig config) {
 		config.addCredentials(this);
@@ -1675,6 +1814,8 @@ public class SDKConnection {
 	}
 	/**
 	 * import a script to the bot
+	 *
+	 * @param config ScriptConfig
 	 */
 	
 	public void importBotScript(ScriptConfig config) {
@@ -1684,6 +1825,8 @@ public class SDKConnection {
 	
 	/**
 	 * import a chatlog/response list to the bot
+	 *
+	 * @param config ScriptConfig
 	 */
 	public void importBotLog(ScriptConfig config) {
 		config.addCredentials(this);
@@ -1693,6 +1836,8 @@ public class SDKConnection {
 	
 	/**
 	 * Save the bot script source
+	 *
+	 * @param config ScriptSourceConfig
 	 */
 	public void saveBotScriptSource(ScriptSourceConfig config) {
 		config.addCredentials(this);
@@ -1701,6 +1846,8 @@ public class SDKConnection {
 	
 	/**
 	 * Delete selected bot script
+	 *
+	 * @param config ScriptSourceConfig
 	 */
 	public void deleteBotScript(ScriptSourceConfig config) {
 		config.addCredentials(this);
@@ -1709,6 +1856,8 @@ public class SDKConnection {
 	
 	/**
 	 * Move up one bot script
+	 *
+	 * @param config ScriptSourceConfig
 	 */
 	public void upBotScript(ScriptSourceConfig config) {
 		config.addCredentials(this);
@@ -1717,6 +1866,8 @@ public class SDKConnection {
 	
 	/**
 	 * Move down one bot script
+	 *
+	 * @param config ScriptSourceConfig
 	 */
 	public void downBotScript(ScriptSourceConfig config) {
 		config.addCredentials(this);
@@ -1725,20 +1876,17 @@ public class SDKConnection {
 	
 	/**
 	 * Return the list of content types.
+	 *
+	 * @return list of content types
 	 */
 	public String[] getTypes() {
 		return types;
 	}
-	
-	/**
-	 * Return the channel types.
-	 */
-	public String[] getChannelTypes() {
-		return channelTypes;
-	}
-	
+
 	/**
 	 * Return the access mode types.
+	 *
+	 * @return access mode types
 	 */
 	public String[] getAccessModes() {
 		return accessModes;
@@ -1746,34 +1894,17 @@ public class SDKConnection {
 	
 	/**
 	 * Return the media access mode types.
+	 *
+	 * @return media access mode types
 	 */
 	public String[] getMediaAccessModes() {
 		return mediaAccessModes;
 	}
-	
-	/**
-	 * Return the learning mode types.
-	 */
-	public String[] getLearningModes() {
-		return learningModes;
-	}
-	
-	/**
-	 * Return the correction mode types.
-	 */
-	public String[] getCorrectionModes() {
-		return correctionModes;
-	}
-	
-	/**
-	 * Return the bot mode types.
-	 */
-	public String[] getBotModes() {
-		return botModes;
-	}
-	
+
 	/**
 	 * Return the current connected user.
+	 *
+	 * @return current connected user
 	 */
 	public UserConfig getUser() {
 		return user;
@@ -1782,6 +1913,8 @@ public class SDKConnection {
 	/**
 	 * Set the current connected user.
 	 * connect() should be used to validate and connect a user.
+	 *
+	 * @param user Set the current connected user
 	 */
 	public void setUser(UserConfig user) {
 		this.user = user;
@@ -1790,6 +1923,8 @@ public class SDKConnection {
 	/**
 	 * Return the current domain.
 	 * A domain is an isolated content space.
+	 *
+	 * @return the current domain
 	 */
 	public DomainConfig getDomain() {
 		return domain;
@@ -1799,6 +1934,8 @@ public class SDKConnection {
 	 * Set the current domain.
 	 * A domain is an isolated content space.
 	 * connect() should be used to validate and connect a domain.
+	 *
+	 * @param domain Set the current domain
 	 */
 	public void setDomain(DomainConfig domain) {
 		this.domain = domain;
@@ -1806,6 +1943,8 @@ public class SDKConnection {
 	
 	/**
 	 * Return the current application credentials.
+	 *
+	 * @return the current application credentials
 	 */
 	public Credentials getCredentials() {
 		return credentials;
@@ -1813,21 +1952,18 @@ public class SDKConnection {
 	
 	/**
 	 * Set the application credentials.
+	 *
+	 * @param credentials Set the application credentials
 	 */
 	public void setCredentials(Credentials credentials) {
 		this.credentials = credentials;
 		this.url = credentials.url;
 	}
-	
-	/**
-	 * Return is debugging has been enabled.
-	 */
-	public boolean isDebug() {
-		return debug;
-	}
-	
+
 	/**
 	 * Enable debugging, debug messages will be logged to System.out.
+	 *
+	 * @param debug boolean
 	 */
 	public void setDebug(boolean debug) {
 		this.debug = debug;
@@ -1835,6 +1971,8 @@ public class SDKConnection {
 	
 	/**
 	 * Return the last thrown exception.
+	 *
+	 * @return the last thrown exception
 	 */
 	public SDKException getException() {
 		return exception;
@@ -1873,6 +2011,13 @@ public class SDKConnection {
 		return xml;
 	}
 
+	/**
+	 * POST
+	 *
+	 * @param url String
+	 * @param xml String
+	 * @return String
+	 * */
 	public String POST(String url, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1910,6 +2055,14 @@ public class SDKConnection {
 		return result;
 	}
 
+    /**
+	 * POSTUpdate
+	 *
+	 * @param xml String
+	 * @param ability Ability
+	 * @param url String
+	 * @return String
+	 * */
 	public String POSTUpdate(Ability ability,String url, String xml) {
 		if (this.debug) {
 			System.out.println("POST: " + url);
@@ -1944,6 +2097,8 @@ public class SDKConnection {
 	 *
 	 * @param client OkHttpClient to get cookies from response
 	 * @param url Http URL
+	 * @param xml String
+	 * @return Response
 	 */
 	public Response getResponse(OkHttpClient client, String url, String xml) {
 		// code request code here
@@ -1960,25 +2115,6 @@ public class SDKConnection {
 		} catch (IOException e) {
 			e.printStackTrace();
 		}
-//		call.enqueue(new Callback() {
-//			@Override
-//			public void onFailure(Call call, IOException exception) {
-//			}
-//
-//			@Override
-//			public void onResponse(Call call, Response response) {
-//				if (response != null && response.body() != null) {
-//					List<String> cookieList = response.headers("Set-Cookie");
-//					StringBuilder stringBuilder = new StringBuilder();
-//					if (cookieList.size() > 0) {
-//						for (String cookie : cookieList) {
-//							stringBuilder.append(cookie).append(",");
-//						}
-//					}
-//					content[0] = response.body().toString();
-//				}
-//			}
-//		});
 		return null;
 	}
 	
@@ -1986,20 +2122,6 @@ public class SDKConnection {
 		if (this.debug) {
 			System.out.println(xml);
 		}
-		Document dom = null;
-		DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance();
-		try {
-			DocumentBuilder builder = factory.newDocumentBuilder();
-			InputSource source = new InputSource();
-			source.setCharacterStream(new StringReader(xml));
-			dom = builder.parse(source);
-			return dom.getDocumentElement();
-		} catch (Exception exception) {
-			if (this.debug) {
-				exception.printStackTrace();
-			}
-			this.exception = new SDKException(exception.getMessage(), exception);
-			throw this.exception;
-		}
+		return (Element) new ShapeElement();
 	}
 }
\ No newline at end of file
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
index fb325e52b0c6a6ae7a3240f806bb52ed2b3d1067..a113dbe2de311c50161407295b3e6911e3a34f63 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/BotSearchAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/BotSearchAbility.java
@@ -16,9 +16,9 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Text;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
index 4857aec94436c243f5e760c8c45eaf611923c401..2e3b695f19bfdc803aee2420629da35a0a9a34be 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/ChatAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/ChatAbility.java
@@ -16,11 +16,11 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.*;
+import org.botlibre.sdk.ability.actions.*;
 import org.botlibre.sdk.config.*;
 import org.botlibre.sdk.provider.ChatListProvicer;
 import org.botlibre.sdk.util.*;
@@ -339,7 +339,7 @@ public class ChatAbility extends LibreAbility {
         @Override
         public void onError(int error) {
             debug("onError:" + error);
-            LogUtils.sop("ChatActivity on error executes here!");
+            LogUtils.sop(" on error executes here!");
             try {
                 isRecording = false;
 
@@ -439,7 +439,7 @@ public class ChatAbility extends LibreAbility {
 //            terminateAbility();
 //            return;
 //        }
-        super.setUIContent(ResourceTable.Layout_activity_chat);
+        super.setUIContent(ResourceTable.Layout_ability_chat);
         ability = this;
         //clear the messages from the listView -
         messages.clear();
@@ -671,16 +671,6 @@ public class ChatAbility extends LibreAbility {
             }
         });
 
-        if (!MainAbility.online) {
-            HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, this.bigImage);
-            HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, (Image) findComponentById(ResourceTable.Id_responseImageView));
-            HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, findComponentById(ResourceTable.Id_icon));
-        } else {
-            //HttpGetImageAction.fetchImage(this, this.instance.avatar, imAvatar);
-            //HttpGetImageAction.fetchImage(this, instance.avatar, this.bigImage);
-            //HttpGetImageAction.fetchImage(this, instance.avatar, (Image) findComponentById(ResourceTable.Id_responseImageView));
-        }
-
         final ChatConfig config = new ChatConfig();
         //config.instance = instance.id;
         config.avatar = this.avatarId;
@@ -726,7 +716,7 @@ public class ChatAbility extends LibreAbility {
             threadIsOn = false;
             active = false;
             try {
-                thread.stop();
+                thread.interrupt();
             } catch (Exception ignore) {
             }
             return thread;
@@ -1171,8 +1161,6 @@ public class ChatAbility extends LibreAbility {
                 this.videoLayout.setVisibility(Component.HIDE);
             }
 
-            HttpGetImageAction.fetchImage(this, this.avatar.avatar, this.bigImage);
-
             AvatarConfig avatarConfig = (AvatarConfig) this.avatar.credentials();
             HttpFetchChatAvatarAction action = new HttpFetchChatAvatarAction(this, avatarConfig);
             action.execute();
@@ -1207,16 +1195,8 @@ public class ChatAbility extends LibreAbility {
         return config.avatar;
     }
 
-    public void resetAvatar(AvatarConfig config) {
-        HttpGetImageAction.fetchImage(this, config.avatar, this.bigImage);
-        HttpGetImageAction.fetchImage(this, config.avatar, (Image) findComponentById(ResourceTable.Id_responseImageView));
-    }
-
     public void MicConfiguration() {
         ToastUtils.showCenterToast(ability,"打开麦克风配置");
-//        Intent intent = getIntent(ability, MicConfiguration.class.getName());
-//        startAbility(intent);
-//        terminateAbility();
     }
 
     @Override
@@ -1280,6 +1260,9 @@ public class ChatAbility extends LibreAbility {
 
     /**
      * Add JavaScript to the HTML to raise postback events to send messages to the bot.
+     *
+     * @param html String
+     * @return String
      */
     public String linkPostbacks(String html) {
         if (html.contains("button")) {
@@ -1566,9 +1549,6 @@ public class ChatAbility extends LibreAbility {
     public Player playAudio(String audio, boolean loop, boolean cache, boolean start) {
         try {
             Uri audioUri = null;
-            if (cache) {
-                audioUri = HttpGetVideoAction.fetchVideo(this, audio);
-            }
             if (audioUri == null) {
                 audioUri = Uri.parse(MainAbility.connection.fetchImage(audio).toURI().toString());
             }
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
index 102a57b730b86e7512a676b51a5620a53b4ac259..5994cf84fbb92a55d08f2c698fb1bb9cb245566c 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/CreateUserAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/CreateUserAbility.java
@@ -16,10 +16,10 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpCreateUserAction;
+import org.botlibre.sdk.ability.actions.HttpCreateUserAction;
 import org.botlibre.sdk.config.UserConfig;
 import org.botlibre.sdk.util.ResUtil;
 import ohos.aafwk.content.Intent;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
index 867233c8dcd3a0c90f17c57333ca6f8f7c46862f..6482acb8bedd2ecf15941cb13b60b6e39e441ea2 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/EmotionalState.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/EmotionalState.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 /**
  * A convenience enum of different emotional states.
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
similarity index 95%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
index 4d34816546b125835bef140d490e966018b9d0c5..3fe761758467de39c6a7641b848c68d56e6431c3 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/HelpAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/HelpAbility.java
@@ -16,13 +16,13 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpFetchAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.actions.HttpResultAction;
+import org.botlibre.sdk.ability.actions.HttpFetchAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.actions.HttpResultAction;
 import org.botlibre.sdk.config.BrowseConfig;
 import org.botlibre.sdk.config.ChannelConfig;
 import org.botlibre.sdk.config.ForumConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/IntentResult.java
similarity index 93%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/IntentResult.java
index 5f5641ed1e2840598e5a9a3eafebf5d774d5bb18..fa6cc8a733c5a233c12b2994bc00a37c872af6bb 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/IntentResult.java
@@ -14,10 +14,10 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 /**
- * <p>Encapsulates the result of a barcode scan invoked through {@link IntentIntegrator}.</p>
+ * <p>Encapsulates the result of a barcode scan invoked through {@link}.</p>
  *
  * @author Sean Owen
  */
@@ -46,6 +46,8 @@ public final class IntentResult {
   }
 
   /**
+   * getContents
+   *
    * @return raw content of barcode
    */
   public String getContents() {
@@ -53,6 +55,8 @@ public final class IntentResult {
   }
 
   /**
+   * getFormatName
+   *
    * @return name of format, like "QR_CODE", "UPC_A". See {@code BarcodeFormat} for more format names.
    */
   public String getFormatName() {
@@ -60,6 +64,8 @@ public final class IntentResult {
   }
 
   /**
+   * getRawBytes
+   *
    * @return raw bytes of the barcode content, if applicable, or null otherwise
    */
   public byte[] getRawBytes() {
@@ -67,6 +73,8 @@ public final class IntentResult {
   }
 
   /**
+   * getOrientation
+   *
    * @return rotation of the image, in degrees, which resulted in a successful scan. May be null.
    */
   public Integer getOrientation() {
@@ -74,6 +82,8 @@ public final class IntentResult {
   }
 
   /**
+   * getErrorCorrectionLevel
+   *
    * @return name of the error correction level used in the barcode, if applicable
    */
   public String getErrorCorrectionLevel() {
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
similarity index 65%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
index 1d0b3384b46d508205fe7bff0747d6e17966cdfe..a4d18ed9178325989766545dd93b1a0e6446741d 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/LibreAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/LibreAbility.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
@@ -26,20 +26,11 @@ import ohos.aafwk.content.Operation;
  * Generic Ability for common behavior.
  */
 public abstract class LibreAbility extends Ability {
-
-	public void help() {
-//		Intent intent = new Intent();
-//		Operation operation = new Intent.OperationBuilder()
-//				.withDeviceId("")
-//				.withBundleName(this.getBundleName())
-//				.withAbilityName(HelpAbility.class.getName())
-//				.build();
-//		intent.setOperation(operation);
-//		startAbility(intent);
-	}
-
 	/**
-	 * 启动activity
+	 * 启动ability
+	 *
+	 * @param ability Ability
+	 * @param name String
 	 */
 	public void startOpenAbility(Ability ability,String name){
 		Intent intent = new Intent();
@@ -51,18 +42,4 @@ public abstract class LibreAbility extends Ability {
 		intent.setOperation(operation);
 		startAbility(intent);
 	}
-
-	/**
-	 * getIntent
-	 */
-	public Intent getIntent(Ability ability, String name) {
-		Intent intent = new Intent();
-		Operation operation = new Intent.OperationBuilder()
-				.withDeviceId("")
-				.withBundleName(ability.getBundleName())
-				.withAbilityName(name)
-				.build();
-		intent.setOperation(operation);
-		return intent;
-	}
 }
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
similarity index 99%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
index ea8b83bcee1072d56b1f90f0b2ad9d0c30db6b2c..8a30f5710b4f81b71b087f51bfbd8ddbc3784d12 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/ListTemplateView.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/ListTemplateView.java
@@ -15,7 +15,7 @@
  *  limitations under the License.
  *
  ******************************************************************************/
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import java.util.ArrayList;
 import java.util.List;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
index 3185099d6ec5187c8bb6e00699b21b68a700fb6c..33443529161e668bbe4b0c7cd5cdf6fbe1282b9d 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/LoginAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/LoginAbility.java
@@ -16,10 +16,10 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpConnectAction;
+import org.botlibre.sdk.ability.actions.HttpConnectAction;
 import org.botlibre.sdk.config.UserConfig;
 import ohos.aafwk.content.Intent;
 import ohos.agp.components.Button;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
index 2eecf1a58e97f54b3842f35846a22cd9744d213e..5bdc6ddfdebbf69036fbe2835437782f9656bee8 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/SearchAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/SearchAbility.java
@@ -16,14 +16,14 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy;
+package org.botlibre.sdk.ability;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.actions.HttpBrowseCategoriesAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
-import org.botlibre.sdk.activityy.dialog.SearchDialogBuilder;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.actions.HttpBrowseCategoriesAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.dialog.SearchDialogBuilder;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.config.BrowseConfig;
 import org.botlibre.sdk.util.PreferencesUtils;
 import org.botlibre.sdk.util.ResUtil;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
similarity index 94%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
index 4b4c8bac5aa4055ca9f9fb3037aa2f396a5028f8..368ca1613e4b7177d9e91a4b180e8b479e3d2d4d 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.util.AsyncTask;
 import ohos.aafwk.ability.Ability;
@@ -40,7 +40,10 @@ public abstract class HttpAction extends AsyncTask<Void, Void, String> {
     }
 
     /**
-     * 启动activity
+     * 启动Ability
+     *
+     * @param ability  Ability
+     * @param name String
      */
     public void startOpenAbility(Ability ability, String name) {
         Intent intent = new Intent();
@@ -65,7 +68,7 @@ public abstract class HttpAction extends AsyncTask<Void, Void, String> {
     }
 
     /**
-     * 启动activity
+     * 启动Ability
      */
     public void startOpenAbilityForResult(Ability ability, String name, int requestCode) {
         Intent intent = new Intent();
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAddAvatarMediaAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAddAvatarMediaAction.java
index c83873af7985cd5cf6ac35ddc8fb4e46e5fb47e3..e0bd534a7d4f157665a028ecc4c3a55db39d99e4 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAddAvatarMediaAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAddAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAvatarMessageAction.java
similarity index 99%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAvatarMessageAction.java
index 448e34a0de096fde5991bacc9a4c66d3d0700d83..116f84d7f4eea5164aebb62da52a1105b6c571e2 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpAvatarMessageAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpAvatarMessageAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpBrowseCategoriesAction.java
similarity index 99%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpBrowseCategoriesAction.java
index 152e8a24ad71348b0b977d1ba08be986da5c9a00..5882f9dc42fb074c2d7ee44c57caf44f0185ed9b 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpBrowseCategoriesAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpBrowseCategoriesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import ohos.aafwk.ability.Ability;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeIconAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeIconAction.java
index ea62e54ec97744105480b532ddb5cfd1f8edcec2..bd6514f4d8a4b49aedd544e35b3cbc674dc4b5e4 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeIconAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeIconAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeUserIconAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeUserIconAction.java
index d1896c134c2a1f85081b043a0f55f36604a89ba6..3639e3c93c4ebe8789200490ea3c2cdb330d1602 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChangeUserIconAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChangeUserIconAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChatAction.java
similarity index 99%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChatAction.java
index b25925b039326e4a8be5960200c3a1a1887613b5..f74982ea2616e4eb7e4b5bd1f78e9fe4291119ef 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpChatAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpChatAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
similarity index 98%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
index 1b518dcc54796500362c502bf60ceaae5438362c..dd3efc61703b320507273886cd2cc06efa6ad289 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpConnectAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpConnectAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
similarity index 98%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
index cd19265d3126450c04e4f83cffc38a7261debd9a..07ab9d620cf25e2d854134a7a68e484704c519c4 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
index 075e27d04afc91bdaa00e48dae011b509fef58bc..10d8ba353dc581e6ba82f998e130cd3b97c8d051 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelFileAttachmentAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelFileAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
index cf874a13752d47400679af080a94b9ccd29a08cd..52f21351d8c71453369dfb422041544acca447df 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateChannelImageAttachmentAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateChannelImageAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
index c452ff0f9df95e9f895e81ad192ed7213492f4f7..6bdb577e7ef3ded32caed03bd1ff0cce17e63d9a 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateForumPostAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueAction.java
index 4893832d1dcc10063bf074880eb26b74b4d0ad72..8c64794dff7311162b5a93259fa93c38ad1ee6b0 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
index f67cdd55bc47111f5f6fdcd0f181c4c9a68552f2..9a62ce614d0c85347b230f20d7109e2152162c23 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerBitmapAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
index 5aa47a9e544067a0fce951ab5dcfb5c1f6a0ce9b..18f8c053134ddcec820b4da8a35dae99b4a92bd1 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerFileAttachmentAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerFileAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
similarity index 96%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
index 5a02f496400c43e900b6bbcc23d26a615b647ef7..dd17bfa37ed020c91d86d206a3cab2a91abc3dc9 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateIssueTrackerImageAttachmentAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateIssueTrackerImageAttachmentAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.MediaConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateReplyAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateReplyAction.java
index f39570cf3c34986ea6af0ffa9559f5578d469e64..e89e3eac48b21b985561744383b4f1b63899e34b 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateReplyAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
index 0b94d353ea519d0f02506a6594146a2876aa19ab..18ff0673a175067bbddea811b127bb7fe77e792a 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserMessageAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserMessageAction.java
index b4e9a82d1eeb2b498226a3ee9d84f08083d047f7..e8b75f39a5126fbbedb71cb42d651a587d98c981 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateUserMessageAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpCreateUserMessageAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAction.java
index 96c1a4f2640ac21fa5cf7650a1e3a3a34fb08299..13a3dd1994f1b862f1819167c1192eb113241e65 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarBackgroundAction.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarBackgroundAction.java
index 85ebd7d08395534df2d3294cde7d8d8b46ab30eb..0eee4bdd0f23de23e237adb617237ae4e259b768 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarBackgroundAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarMediaAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarMediaAction.java
index 3ab854bdaf1593140f1403ad73108934507495e5..7c70b8f70ed0a082275cda7c755b751b6288deda 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarMediaAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteBotScriptAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteBotScriptAction.java
index e516361666951b2838f11f84958294129463073d..ff496dac9a805e29df2d846eac6a173344a035b7 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteBotScriptAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteBotScriptAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptSourceConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
index c2b719f086169b95e0c9bd7fb34dcd6870970c91..2064883e58e361555e972249f0858c1056857ba6 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteForumPostAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ForumPostConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteIssueAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteIssueAction.java
index 70c8ca32b44967c1f65154ccd2a1e47b749b2611..57408fea9f88b4aea9900bf5e87a846588f929a4 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.IssueConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteResponseAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteResponseAction.java
index a2bdc5e0c21fad0bcaf45dbe92c0cbb71dbc313e..9c00c2ff9a16a9f026f245eda6edeb3f41152735 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDeleteResponseAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ResponseConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDownBotScriptAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDownBotScriptAction.java
index 6e98c941e21d3c73f3dd98dc2360aee06c6ee4df..a7165d948a6f1c8d3ec94143a1c9125005f3dc56 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpDownBotScriptAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptSourceConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
index 3e2efbb41a4035fd1f0d2413b845d18d87c90f98..fcee694a304733015b830a7763a5b43442683c1d 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.*;
@@ -64,7 +64,7 @@ public class HttpFetchAction extends HttpUIResultAction {
         	cookies.putString(this.config.getType(), this.config.name);
         	cookies.flushSync();
 
-        	Class childAbility = MainAbility.getActivity(this.config);
+        	Class childAbility = MainAbility.getAbility(this.config);
         	if (this.launch && !this.config.isExternal) {
 	        	if (this.config instanceof ChannelConfig) {
 //	        		childAbility = LiveChatAbility.class;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchActionOffline.java
similarity index 78%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchActionOffline.java
index 0ad3a44c5ad61463e081e9ae487eee39ab225787..28db99ca98fde1e81f2449f09a49cefb65b7ea96 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchActionOffline.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchActionOffline.java
@@ -16,12 +16,12 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.activityy.ListTemplateView;
+import org.botlibre.sdk.ability.ChatAbility;
+import org.botlibre.sdk.ability.ListTemplateView;
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
 import org.botlibre.sdk.micro.MicroConnection;
@@ -93,7 +93,7 @@ public class HttpFetchActionOffline extends HttpUIAction {
 		}
 		try {
 			MainAbility.instance = this.config;
-			Class childAbility = MainAbility.getActivity(this.config);
+			Class childAbility = MainAbility.getAbility(this.config);
 			if (this.launch && !this.config.isExternal) {
 				if (this.config instanceof InstanceConfig) {
 					childAbility = ChatAbility.class;
@@ -114,27 +114,6 @@ public class HttpFetchActionOffline extends HttpUIAction {
 	@Override
 	public void onPostExecute(String xml) {
 		super.onPostExecute(xml);
-//		if(this.ability instanceof ListTemplateView){
-//			this.ability.terminateAbility();
-//		}
-//		if (this.exception != null) {
-//			return;
-//		}
-//		try {
-//			MainAbility.instance = this.config;
-//        	Class childAbility = MainAbility.getActivity(this.config);
-//        	if (this.launch && !this.config.isExternal) {
-//	        	if (this.config instanceof InstanceConfig) {
-//	        		childAbility = ChatAbility.class;
-//	        		HttpAction action = new HttpGetVoiceAction(this.ability, (InstanceConfig)MainAbility.instance.credentials());
-//	        		action.execute();
-//	        	}
-//	        }
-//			startOpenAbility(this.ability,childAbility.getName());
-//		} catch (Exception error) {
-//			this.exception = error;
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//			return;
-//		}
+
 	}
 }
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchBotAvatarAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchBotAvatarAction.java
index 450488df8f5e8a014bd3f351003a115c7935bf66..d8f79f1dbf399cfecdaa73ee416ee7ebf77d14fb 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchBotAvatarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchChatAvatarAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchChatAvatarAction.java
index 213bebc6abf9f7f8fceeb894f4c730a055e388a0..fa0b984363739d8ad83de0e2db0f4b0312d6a1ed 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchChatAvatarAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchChatAvatarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchForumPostAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchForumPostAction.java
index b723aacb1a676648f1a01c859c4fa8aaa2019c92..80792158bc52a62b67810af0e99d8ec99f57ef6b 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ForumPostConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchIssueAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchIssueAction.java
index 47d182f66999a35d8b57e030816f13f2475d5e28..60cdcae54bd5981feb4fca0d74a0c4dc01c6a124 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.IssueConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
index e0ef846b3a366a15c2f7175e0d617dbf16ac78d6..60e055ff9652220789ea2f35446a833013264940 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchOrCreateAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchOrCreateAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchUserAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchUserAction.java
index 7fe3d6bdc3ed27fc56041b2525a5e99bb339a420..309cb81618e3a61c587edbcd9e4bff39b57a892e 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchUserAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.UserConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchWarAction.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchWarAction.java
index 5a4108c949a93a6fb987985b978d061f95e7cc16..26381dcf81a52e9020890c1944b5598ec9386f13 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchWarAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFetchWarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.config.WebMediumConfig;
 import ohos.aafwk.ability.Ability;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagAction.java
index 92293cf14d773a4088d7d6b5c162cab10dc7b691..6be6e121b9890d159431f3a5ec817768277d725d 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagForumPostAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagForumPostAction.java
index 8782d8d0e169254356caab4fb9a9c54c17b0a599..1f2bb643445b9aaa71d0b39f16f0450dd7434ab6 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagForumPostAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ForumPostConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagIssueAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagIssueAction.java
index ba7ee1b6a02bac03af0bc1b692089738deffc7fe..1accaa47641a1ff71684b3ddffbe7b2aff3b1294 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.IssueConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
index 876e4f00d97462425debd6f85421e70f670742cc..6222aeb7081223e23c9b016988fd98557e0e34ea 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFlagUserAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpFlagUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.UserConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAdminsAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAdminsAction.java
index fb9f238d0892a499b5ce12aa9ce7bd9b2d38b5c4..e108044bc02e311f0c7187d32eadf23ec73165b6 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAdminsAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAdminsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
index 7859eeab096d36455c99abd8029e5de02cfec841..9e2aff1ba6938c2632039624bd30bdbd13535388 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetAvatarMediaAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptSourceAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptSourceAction.java
index 2e1f0d485d25c88bcf9345524b4e2737d63a2b9e..136e788c80c3bb456ebf074b820c33631bb085e8 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptSourceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptSourceConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptsAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptsAction.java
index 6702275bc375bb36b7890dcb9615be7dbf9ccd8a..b1876b7a2688c2a4a826701ace799e3eb2910981 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptsAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetBotScriptsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.InstanceConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetCategoriesAction.java
similarity index 98%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetCategoriesAction.java
index eea8e1fbe9cdf31c4114d20f96a81b013eb74697..150ed0856d28f2686e9d483e1d1d3bbad19295ff 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetCategoriesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ContentConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetChannelBotModeAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetChannelBotModeAction.java
index 54ce4a48090960bc13514419d93e41bb8d7cf3a4..8a33f9465dae904fd7193700d907ff2fec990d5e 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetChannelBotModeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 
 import org.botlibre.sdk.MainAbility;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetConversationsAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetConversationsAction.java
index 8405db85144d1a04de0662c6c208df09284acff4..ca2e164715300266566a94378ba22a2937f24660 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetConversationsAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetConversationsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ConversationConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetForumBotModeAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetForumBotModeAction.java
index 7aeccc1f7248492df6cd3d373236ced01e6c105d..097da16513869b0cd5b59cc503e1a0d59ee2a2c0 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetForumBotModeAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetForumBotModeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.BotModeConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
similarity index 99%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
index 710b66f9925d214f033f207c1ee90d339fbc801d..d9eb94280adbd2a4b22908c51895ae16ff014009 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetInstancesAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetInstancesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.BrowseConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetIssuesAction.java
similarity index 98%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetIssuesAction.java
index 70a0f3dce20f49072019b2fb0a7f00ff06639e3c..8ddd1cda98d4e5ac00c3fe334b9e42a0f4246fc4 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetIssuesAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetIssuesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.BrowseConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
index 078f1ed08c11e1be3798303dfe8282dd59983108..40e01a437282e334daf74a2f3f02e0b1d7225302 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLearningAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLearningAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.InstanceConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLiveChatUsersAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLiveChatUsersAction.java
index 2c9566f93726186856ca3f2f79218b05902dc1a6..4a32049f9eb652222593df49d9d35c14da193db3 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetLiveChatUsersAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetLiveChatUsersAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
similarity index 98%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
index 8162d98286151a7c0727c06c60b44a218dcf6ed5..09f2164cca848c27379a0ee2fcad425fd34291e4 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetPostsAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetPostsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetResponsesAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetResponsesAction.java
index 560b4892c062ea316c871140714f2882df993625..ace1bddabe60b30a6d10c736164922c06c81b8f7 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetResponsesAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetResponsesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetScriptSourceAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetScriptSourceAction.java
index a9dff7cd95d68685028b6350f19153281d3c6977..a45af42c1bf33b311770beb8a3aa59e18b41469f 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetScriptSourceAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetScriptSourceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTagsAction.java
similarity index 98%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTagsAction.java
index b3a658f477c801e9aa4ce2de9ed20de10044954f..94a0ebf70202bf89b2b69bb152c04ed0beb3faed 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTagsAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTagsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
index 2a8e59efd665ad22441d81beda15829da0519229..cf41f9c81aefcfb292699e84e16057d6138f270b 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetTemplatesAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetTemplatesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetUsersAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetUsersAction.java
index 0b1eb32bf7b02b5e1fd40edd01abb83994444de7..e29ada173abe363352db32fdce3d9f859a55bfff 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetUsersAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetVoiceAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetVoiceAction.java
index 6e8cbe4941bc973d30568267d0333cea0d2494bf..c35f9dbb565b916d489148f6d47d574c968a1113 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVoiceAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpGetVoiceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotLogAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotLogAction.java
index 2de192312807f618aa88b9147b9a9e89ddd7a8de..890a120e3847753bb3f5d342e75582bb7703885e 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotLogAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptConfig;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotScriptAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotScriptAction.java
index c984d17e2436d7149cbf1d4baf108c85af6fa5aa..1c1efd6390481be1291094f1cf928713f976ee7f 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotScriptAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpImportBotScriptAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageInstancesAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageInstancesAction.java
index 0431d849bd37355817bf8f6a6a03c9994f5db279..1cdbe1ba8c0d0e2c8adc8811f57ee86854ffc8b0 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageInstancesAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageInstancesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageIssuesAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageIssuesAction.java
index 74aef5d5a0035f65043618cc78f922f1f71d7c35..3af4248a8de15f9c6d1ae33f6bea9579965a1eee 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPageIssuesAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPagePostsAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPagePostsAction.java
index 2d5fdea8ad00f43bd4d6a19e8b1980afa53d00f6..cffe81b03f37193e3ff912eaa513cde88fcf96cf 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPagePostsAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpPagePostsAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import java.util.List;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpRefreshAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpRefreshAction.java
index db5535421227d2c23a13a850106d620e6a845a3f..ac80bcc174553a3c140aefcf74e05e8ea8ced10c 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpRefreshAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpRefreshAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
  
- package org.botlibre.sdk.activityy.actions;
+ package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
similarity index 89%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
index 22af1fed73d6fef34c004eb62b44ee19fbd64fd8..b3b4d6e1871dabfef0f22c68bfa4fe245aa70cb1 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpResultAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpResultAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import ohos.aafwk.ability.Ability;
 import ohos.aafwk.content.Intent;
@@ -39,7 +39,10 @@ public abstract class HttpResultAction{
     }
 
     /**
-     * 启动activity
+     * 启动Ability
+     *
+     * @param ability Ability
+     * @param name String
      */
     public void startOpenAbility(Ability ability, String name) {
         Intent intent = new Intent();
@@ -53,7 +56,11 @@ public abstract class HttpResultAction{
     }
 
     /**
-     * 启动activity
+     * 启动Ability
+     *
+     * @param ability Ability
+     * @param name String
+     * @param requestCode int
      */
     public void startOpenAbilityForResult(Ability ability, String name, int requestCode) {
         Intent intent = new Intent();
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarBackgroundAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarBackgroundAction.java
index 587c7257adf18e8ff6152b619796f1b5d5758fe6..5dbe144d9c587df14629658b65d70234761c5100 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarBackgroundAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarMedia;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarMediaAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarMediaAction.java
index 18ee6f3a64b78423e963651d94399f2fc612f5d6..9d2f34f17d18d21cbe719b8446ae5b3294d75591 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarMediaAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveAvatarMediaAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.AvatarMedia;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotAvatarAction.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotAvatarAction.java
index 7031146ac6d3001f5e4daa85e1c1986f65c0f267..6b9a1ffcb3ddfc224a34908caa057120eab03829 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotAvatarAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotAvatarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotScriptSourceAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotScriptSourceAction.java
index 08122ddf48e99870f10fd153798c5951a92de145..757f22710477b641a2347e95aee2339c3e513aa3 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveBotScriptSourceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveChannelBotModeAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveChannelBotModeAction.java
index c8b6665c06a055ea9b1bd3a3c68cfd635fd63fcc..d68cb564a3f48ab9190720e96737e781bc10bde1 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveChannelBotModeAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveChannelBotModeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveForumBotModeAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveForumBotModeAction.java
index a03999fb83df6d6e0ec3247eeb18647c37ffffe0..e543c5335d36dfd3c6f41966c49f7607da4573d6 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveForumBotModeAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveForumBotModeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveLearningAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveLearningAction.java
index 1e8b761a241003d8c0f132817940ac94fe6913ef..02dbde72f791c2e0cbb16a0a3d7af20f451f890e 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveLearningAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveLearningAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveResponseAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveResponseAction.java
index e075572af1516334f9c6aac798a261e712b7361d..4cd099a42926ddb86cd7e7776021eefa071e021d 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveResponseAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveResponseAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveScriptSourceAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveScriptSourceAction.java
index 9c636ff8ab32cb8be007c0e09b2319c60bbb7fbc..1bdb6bfba89c4cebbbbb72a2200c5cc5259c69e2 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveScriptSourceAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveScriptSourceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveVoiceAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveVoiceAction.java
index 1a1228828e020c531e56dfdddf61517feb88193a..e0029f3152d3363f756075c69a6a8686ad69d1eb 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveVoiceAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSaveVoiceAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSpeechAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSpeechAction.java
index eeed3b90239cadccad6791df57c85f8a2f706458..4713af14569d81a40780a40e8d7d5a044a2311c9 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSpeechAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSpeechAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarAction.java
index 3cf693ce0e206042caef81d3a9caf9cf2e92f485..fa4dd010d160e8993c0d95eecc4f03c11c0eed43 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarIssueAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarIssueAction.java
index 8d06013cea0c233e4b17f01bb3fb03260a3b6de7..37f42a6e21e6f75669e4f29b71a33616a16ac035 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarPostAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarPostAction.java
index c8156298a108b82394309f8727bb2d6d445cb5b6..362254f33d49f9cb754f79ff070217b410625268 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarPostAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpStarPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeAction.java
index fd20173aafdf9c5f44e249b6f933a32fae571d50..0e8d6becef2d1f80820a308c5b70fe21ad60cb6e 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeForumAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeForumAction.java
index 0031ff92da6c9fbb2fde53ec00b864349c57142a..5596e5e9b8cbd9dae95b99ec593be4044f774e39 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeForumAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeForumAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeIssueAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeIssueAction.java
index 78dd4d46c6e5158d26570ee9bf76e3096f906b2c..39c23eb175bc36235dd9b8a93eb273f343748093 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSubscribeIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpSubscribeIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownAction.java
index dc358e874865654b88dd5c2c8edaf594cb7dc68e..a86ba055c262814625aba8e215a36a587ec2712b 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownIssueAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownIssueAction.java
index ee2348f437b3b5608dbf8f529715d1e34dbbb790..7a7e0f428f8c211ec0cc19bafd991bf90dc1b0c6 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownPostAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownPostAction.java
index fa19590eace83bb6798d6257e8f09ddb393cfb23..7a59fbba011d88e10e503643608314f64ce86b8b 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsDownPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpAction.java
index b030c09091b9bc65b168e203d139a5b621c96ecc..b0126f3043fd292d91f49a385c5cf0eaf44da196 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpIssueAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpIssueAction.java
index 0c34c41412887316a1229c8c9190268a3c160ce3..da56faca17c9ec29891f829a935ba9c1d9b93657 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.IssueConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpPostAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpPostAction.java
index a843d0794353081e9ad62d22b70c06a53f0825d9..6e37aabe120c4c4cb5ce83ab2aef921b429884eb 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsUpPostAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpThumbsUpPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
similarity index 98%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
index 272969d74471a4ceaf9f84ee2d50d2d06850d58b..f0093abe4928264a0e779a964ff7c836f7cbb33c 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
similarity index 98%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
index 364bee86c2792588d97d9e6be34525b4b4d93301..db20c9023af46e0008fb620fd18187d4a867c22d 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUIResultAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUIResultAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeAction.java
index 938262e5f1cdd51b81a07b885856a86257a2b382..dad3fbad1d8b2330d35b0cebeb9268c22d862333 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeForumAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeForumAction.java
index 7c4c9179fc335c1d23f6a5099660e1c5e1c3fafc..77dc0015f06fafcf47268aa4e2f425b77f7fa89e 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeForumAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeForumAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeIssueAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeIssueAction.java
index 229fa929e0a4c2cd33972f85edb50cf78ba973ec..8123b845b3e61bfa8492912f373d4168b91cbb79 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUnsubscribeIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpBotScriptAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpBotScriptAction.java
index 9d456711443e3bfd3b84c96a1eb8d04098a2c05c..ee4c2d3549ac156c03023e1a18663589784c0d13 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpBotScriptAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpBotScriptAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.config.ScriptSourceConfig;
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateAction.java
index cafad9bad01c877f74826c37c25ac8307af9a2ad..77ec1d84c42616aa7415302fbea0547a089b99aa 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateForumPostAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateForumPostAction.java
index 846ae93004bdb99f9e7051145baca1504d0cee32..b325daba805a9c907a7f79137b1f8a8346b0bec1 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateForumPostAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateForumPostAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateIssueAction.java
similarity index 97%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateIssueAction.java
index 2374b85e68a40b26560ca137f780c2ec40d12af3..3723641a016e8714ce69ad40b6595ff4ad2af623 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateIssueAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateIssueAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateUserAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateUserAction.java
index 2a412260e4c52dc1da04735e66f99bf698569930..0097bbc6e66a2ef6905f9bcc60944694863849f8 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateUserAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUpdateUserAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUploadGraphicMediaAction.java
similarity index 97%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUploadGraphicMediaAction.java
index b7b7065c55055ee1590601dea625bf7559aa69ad..63419c8d226e769376b37cbbefd0002b6ba38f0c 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUploadGraphicMediaAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUploadGraphicMediaAction.java
@@ -15,7 +15,7 @@
  *  limitations under the License.
  *
  ******************************************************************************/
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserAdminAction.java
similarity index 98%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserAdminAction.java
index 2124ff3c5497c51f6400e661949cadd76313d638..cff08c49b2ecdc816029eb2c01c7092b699cca28 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserAdminAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserAdminAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserMessageAction.java
similarity index 97%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserMessageAction.java
index 76cd86884ffbabae44d1f09483764a44036ee87a..4b23f23180e69ff3a39b179709851310d790f9ae 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/HttpUserMessageAction.java
@@ -16,7 +16,7 @@
 *
 ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.MainAbility;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/WarAction.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/WarAction.java
index 01215f2ed60eea3d5a4d4c6fccc2078af443ef93..ef0a8257460de4c558d8dd401cf4903b653756dc 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/actions/WarAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/actions/WarAction.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.actions;
+package org.botlibre.sdk.ability.actions;
 
 import org.botlibre.sdk.config.ChatResponse;
 
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
index 0a708de062101d0f440fbab96dd0eb7051bd493d..6b6e5f7a5b4508551fdbe969d3169da9981da5e5 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/adapter/SpinnerAdapter.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/adapter/SpinnerAdapter.java
@@ -13,7 +13,7 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.adapter;
+package org.botlibre.sdk.ability.adapter;
 
 import org.botlibre.sdk.ResourceTable;
 import ohos.aafwk.ability.Ability;
@@ -30,7 +30,7 @@ import ohos.agp.components.Text;
  * @since 2021-05-10
  */
 public class SpinnerAdapter extends BaseItemProvider {
-    private final Ability mActivity;
+    private final Ability mAbility;
     private final LayoutScatter mInflater;
     private final String[] types;
 
@@ -41,7 +41,7 @@ public class SpinnerAdapter extends BaseItemProvider {
      * @param types types
      */
     public SpinnerAdapter(Ability ability, String[] types) {
-        mActivity = ability;
+        mAbility = ability;
         this.types = types;
         mInflater = LayoutScatter.getInstance(ability);
     }
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
similarity index 74%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
index 1ba617525f7f0225dbdb153a853e35ffcc005dd1..a75ead36800635748095bc8f89239222aa9e7517 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/avatar/AvatarSelection.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/avatar/AvatarSelection.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.avatar;
+package org.botlibre.sdk.ability.avatar;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
@@ -31,14 +31,13 @@ import ohos.data.preferences.Preferences;
 import java.util.ArrayList;
 
 /**
- * Activity used for selecting an offline avatar.
+ *  used for selecting an offline avatar.
  */
 public class AvatarSelection extends Ability {
 
 	@Override
 	public void onStart(Intent intent) {
 		super.onStart(intent);
-//		setContentView(R.layout.activity_list_view);
 		super.setUIContent(ResourceTable.Layout_ability_list_view);
 		final int [] imges = {};
 		final String [] names = {};
@@ -48,16 +47,7 @@ public class AvatarSelection extends Ability {
 		for (int i = 0; i < names.length; i++) {
 			items.add(new OfflineTemplateConfig(imges[i],names[i],null,null));
 		}
-//		CustomListViewAdapter adapter = new CustomListViewAdapter(this, R.layout.list_item_imager, items);
-//		listView.setAdapter(adapter);
-//		listView.setOnItemClickListener(new OnItemClickListener(){
-//			@Override
-//			public void onItemClick(AdapterView<?> parent, View view, int position, long id) {
-//				OfflineTemplateConfig template = (OfflineTemplateConfig) (listView.getItemAtPosition(position));
-//				saveSelectedAvatar(template.getTitle());
-//				MainActivity.readZipAvatars(AvatarSelection.this, MainActivity.nameOfAvatar);
-//				finish();
-//			}});
+
 	}
 
 	public static void saveSelectedAvatar(String nameOfAvatar) {
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
index c15fc3a71ee6f86d77cbb6fcd913ea40914d24b5..b14752da2ad09c11c8ac78699949724ab1af4531 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/LanguageDialogBuilder.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/LanguageDialogBuilder.java
@@ -13,12 +13,12 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.LanguageListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.LanguageListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
similarity index 96%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
index a1f99136eee7867944196c488934bdfef0482374..34c67053c103c3e2a87c24dca243287ed1c7ee15 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SearchDialogBuilder.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/SearchDialogBuilder.java
@@ -13,11 +13,11 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
index 929116aa9dc948e3e73c7225d35bcad2c4b79efe..d8caef1fa97f65a4d41c50e0c281907e74135f3d 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/dialog/SpinnerDialogBuilder.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/dialog/SpinnerDialogBuilder.java
@@ -13,12 +13,12 @@
  * limitations under the License.
  */
 
-package org.botlibre.sdk.activityy.dialog;
+package org.botlibre.sdk.ability.dialog;
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.adapter.SpinnerAdapter;
-import org.botlibre.sdk.activityy.listener.SelectListener;
+import org.botlibre.sdk.ability.adapter.SpinnerAdapter;
+import org.botlibre.sdk.ability.listener.SelectListener;
 import org.botlibre.sdk.util.Constant;
 import ohos.aafwk.ability.Ability;
 import ohos.agp.components.Component;
diff --git a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
similarity index 93%
rename from BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
index 776ecddd89448fdd01e97b8cd024a4ce6736c227..8e66c9b7c1b68df7c1d5b4eb98bbbc80e35f2e86 100644
--- a/BotLibre/entry/src/main/java/org/botlibre/sdk/activityy/listener/LanguageListener.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/listener/LanguageListener.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.listener;
+package org.botlibre.sdk.ability.listener;
 
 /**
  * Listener interface for a LiveChatConnection.
@@ -25,6 +25,8 @@ package org.botlibre.sdk.activityy.listener;
 public interface LanguageListener {
 	/**
 	 * A user message was received from the channel.
+	 *
+	 * @param select String
 	 */
 	void selectLanguageItem(String select);
 }
\ No newline at end of file
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
similarity index 93%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
index 237a4130230d4315b6104d3b10fd8da115e72fed..12704d21752ed72cd0325f2b27b718487896f1ce 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/listener/SelectListener.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/listener/SelectListener.java
@@ -16,7 +16,7 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.listener;
+package org.botlibre.sdk.ability.listener;
 
 /**
  * Listener interface for a LiveChatConnection.
@@ -25,6 +25,8 @@ package org.botlibre.sdk.activityy.listener;
 public interface SelectListener {
 	/**
 	 * A user message was received from the channel.
+	 *
+	 * @param select String
 	 */
 	void selectItem(String select);
 }
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
similarity index 95%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
index f943da9e2cbeee5b38c510ba220f2c56237be175..7d0c9ee38abd0e72dae4d758dbfb3b6108be35eb 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/ChatWarConfig.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/ChatWarConfig.java
@@ -1,4 +1,4 @@
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 import org.botlibre.sdk.config.Config;
 
diff --git a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
similarity index 80%
rename from BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
index ac0405d955ae27c6ef32f219ba714625c676f441..1c0419f9a72e8569c22923923a87c3b55b740012 100644
--- a/BotLibreOffline/entry/src/main/java/org/botlibre/sdk/activityy/war/HttpChatWarAction.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/HttpChatWarAction.java
@@ -1,7 +1,7 @@
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.actions.HttpUIAction;
+import org.botlibre.sdk.ability.actions.HttpUIAction;
 import org.botlibre.sdk.config.InstanceConfig;
 import ohos.aafwk.ability.Ability;
 
@@ -9,8 +9,8 @@ public class HttpChatWarAction extends HttpUIAction {
 	ChatWarConfig config;
 	InstanceConfig instance;
 
-	public HttpChatWarAction(Ability activity, ChatWarConfig config) {
-		super(activity);
+	public HttpChatWarAction(Ability ability, ChatWarConfig config) {
+		super(ability);
 		this.config = config;
 	}
 
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
similarity index 96%
rename from SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java
rename to SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
index 0e3bb78a893e66f9befea773c0a0eb53c5276bda..b1c3f9e0f139105b7da0ae2041ae5c33c51607d3 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/war/StartWarAbility.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/ability/war/StartWarAbility.java
@@ -16,14 +16,14 @@
  *
  ******************************************************************************/
 
-package org.botlibre.sdk.activityy.war;
+package org.botlibre.sdk.ability.war;
 
 
 import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.activityy.LibreAbility;
-import org.botlibre.sdk.activityy.actions.HttpFetchWarAction;
-import org.botlibre.sdk.activityy.actions.HttpGetInstancesAction;
+import org.botlibre.sdk.ability.LibreAbility;
+import org.botlibre.sdk.ability.actions.HttpFetchWarAction;
+import org.botlibre.sdk.ability.actions.HttpGetInstancesAction;
 import org.botlibre.sdk.config.BrowseConfig;
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.WebMediumConfig;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java
deleted file mode 100644
index 974e7041f5a8b8f9d1120d99d79dfbaa4907e0b4..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/BaseAbility.java
+++ /dev/null
@@ -1,12 +0,0 @@
-package org.botlibre.sdk.activityy;
-
-import ohos.aafwk.ability.Ability;
-import ohos.aafwk.content.Intent;
-
-public class BaseAbility extends Ability {
-    @Override
-    public void onStart(Intent intent) {
-        super.onStart(intent);
-    }
-
-}
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java
deleted file mode 100644
index 5f5641ed1e2840598e5a9a3eafebf5d774d5bb18..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/IntentResult.java
+++ /dev/null
@@ -1,95 +0,0 @@
-/*
- * Copyright 2009 ZXing authors
- *
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *      http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.botlibre.sdk.activityy;
-
-/**
- * <p>Encapsulates the result of a barcode scan invoked through {@link IntentIntegrator}.</p>
- *
- * @author Sean Owen
- */
-public final class IntentResult {
-
-  private final String contents;
-  private final String formatName;
-  private final byte[] rawBytes;
-  private final Integer orientation;
-  private final String errorCorrectionLevel;
-
-  IntentResult() {
-    this(null, null, null, null, null);
-  }
-
-  IntentResult(String contents,
-               String formatName,
-               byte[] rawBytes,
-               Integer orientation,
-               String errorCorrectionLevel) {
-    this.contents = contents;
-    this.formatName = formatName;
-    this.rawBytes = rawBytes;
-    this.orientation = orientation;
-    this.errorCorrectionLevel = errorCorrectionLevel;
-  }
-
-  /**
-   * @return raw content of barcode
-   */
-  public String getContents() {
-    return contents;
-  }
-
-  /**
-   * @return name of format, like "QR_CODE", "UPC_A". See {@code BarcodeFormat} for more format names.
-   */
-  public String getFormatName() {
-    return formatName;
-  }
-
-  /**
-   * @return raw bytes of the barcode content, if applicable, or null otherwise
-   */
-  public byte[] getRawBytes() {
-    return rawBytes;
-  }
-
-  /**
-   * @return rotation of the image, in degrees, which resulted in a successful scan. May be null.
-   */
-  public Integer getOrientation() {
-    return orientation;
-  }
-
-  /**
-   * @return name of the error correction level used in the barcode, if applicable
-   */
-  public String getErrorCorrectionLevel() {
-    return errorCorrectionLevel;
-  }
-  
-  @Override
-  public String toString() {
-    StringBuilder dialogText = new StringBuilder(100);
-    dialogText.append("Format: ").append(formatName).append('\n');
-    dialogText.append("Contents: ").append(contents).append('\n');
-    int rawBytesLength = rawBytes == null ? 0 : rawBytes.length;
-    dialogText.append("Raw bytes: (").append(rawBytesLength).append(" bytes)\n");
-    dialogText.append("Orientation: ").append(orientation).append('\n');
-    dialogText.append("EC level: ").append(errorCorrectionLevel).append('\n');
-    return dialogText.toString();
-  }
-
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java
deleted file mode 100644
index f39570cf3c34986ea6af0ffa9559f5578d469e64..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpCreateReplyAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpCreateReplyAction extends HttpUIAction {
-	
-	ForumPostConfig config;
-
-	public HttpCreateReplyAction(Ability ability, ForumPostConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.createReply(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.post = this.config;
-			
-			this.ability.terminateAbility();
-	        
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java
deleted file mode 100644
index 85ebd7d08395534df2d3294cde7d8d8b46ab30eb..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteAvatarBackgroundAction.java
+++ /dev/null
@@ -1,43 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpDeleteAvatarBackgroundAction extends HttpUIAction {
-
-	AvatarConfig config;
-	
-	public HttpDeleteAvatarBackgroundAction(Ability ability, AvatarConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.deleteAvatarBackground(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java
deleted file mode 100644
index a2bdc5e0c21fad0bcaf45dbe92c0cbb71dbc313e..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDeleteResponseAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ResponseConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpDeleteResponseAction extends HttpUIAction {
-
-	ResponseConfig config;
-	
-	public HttpDeleteResponseAction(Ability ability, ResponseConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.delete(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		((TrainingAbility)this.ability).getResponses().remove(this.config);
-//		((TrainingAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java
deleted file mode 100644
index 6e98c941e21d3c73f3dd98dc2360aee06c6ee4df..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpDownBotScriptAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpDownBotScriptAction extends HttpUIAction {
-	
-	ScriptSourceConfig config;
-
-	public HttpDownBotScriptAction(Ability ability, ScriptSourceConfig config) {
-		super(ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.downBotScript(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.script = this.config;
-		
-//	   ((BotScriptsAbility)this.ability).resetView();
-	}
-
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java
deleted file mode 100644
index 450488df8f5e8a014bd3f351003a115c7935bf66..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchBotAvatarAction.java
+++ /dev/null
@@ -1,57 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpFetchBotAvatarAction extends HttpUIAction {
-	AvatarConfig config;
-
-	public HttpFetchBotAvatarAction(Ability ability, AvatarConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-//			((BotAvatarAbility)this.ability).resetAvatar(this.config);
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java
deleted file mode 100644
index b723aacb1a676648f1a01c859c4fa8aaa2019c92..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpFetchForumPostAction.java
+++ /dev/null
@@ -1,64 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpFetchForumPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpFetchForumPostAction(Ability ability, ForumPostConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.fetch(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.post = this.config;
-			
-//			if (this.ability instanceof ForumPostAbility) {
-//				this.ability.terminateAbility();
-//			}
-//
-//	        startOpenAbility(this.ability, ForumPostAbility.class.getName());
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java
deleted file mode 100644
index 2e1f0d485d25c88bcf9345524b4e2737d63a2b9e..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetBotScriptSourceAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpGetBotScriptSourceAction extends HttpUIAction {
-	ScriptSourceConfig config;
-	
-	public HttpGetBotScriptSourceAction(Ability ability, ScriptSourceConfig config) {
-		super(ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.config = MainAbility.connection.getBotScriptSource(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) { 
-		super.onPostExecute(xml);
-		if (this.exception != null) { 
-			return;
-		}
-		try {
-			MainAbility.script = this.config;
-			
-//			((BotScriptEditorAbility)this.ability).resetView();
-			
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java
deleted file mode 100644
index eea8e1fbe9cdf31c4114d20f96a81b013eb74697..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetCategoriesAction.java
+++ /dev/null
@@ -1,105 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ContentConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.ArrayList;
-import java.util.List;
-
-public class HttpGetCategoriesAction extends HttpAction {
-//	ListView llview;
-	ContentConfig config;
-	Object[] categories;
-	List<ContentConfig> listCategories;
-
-	public HttpGetCategoriesAction(Ability Ability, String type) {
-		super(Ability);
-		this.config = new ContentConfig();
-		this.config.type = type;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		if (this.config.type.equals("Bot") && MainAbility.categories != null) {
-			this.categories = MainAbility.categories;
-		} else if (this.config.type.equals("Forum") && MainAbility.forumCategories != null) {
-			this.categories = MainAbility.forumCategories;
-		} else if (this.config.type.equals("Channel") && MainAbility.channelCategories != null) {
-			this.categories = MainAbility.channelCategories;
-		} else if (this.config.type.equals("Avatar") && MainAbility.avatarCategories != null) {
-			this.categories = MainAbility.avatarCategories;
-		} else if (this.config.type.equals("Script") && MainAbility.scriptCategories != null) {
-			this.categories = MainAbility.scriptCategories;
-		} else if (this.config.type.equals("Domain")&&MainAbility.domainCategories != null) {
-			this.config.domain = null;
-			this.categories = MainAbility.domainCategories;
-		} else {
-			try {
-				this.categories = MainAbility.connection.getCategories(this.config).toArray();
-			} catch (Exception exception) {
-				this.exception = exception;
-				this.categories = new Object[0];
-			}
-		}
-		return "";
-	}
-
-	@SuppressWarnings({ "rawtypes" })
-	@Override
-	public void onPostExecute(String xml) {
-		if (this.exception != null) {
-			return;
-		}
-		if (this.config.type.equals("Bot")) {
-			MainAbility.categories = this.categories;
-		} else if (this.config.type.equals("Forum")) {
-			MainAbility.forumCategories = this.categories;
-		} else if (this.config.type.equals("Channel")) {
-			MainAbility.channelCategories = this.categories;
-		} else if (this.config.type.equals("Avatar")) {
-			MainAbility.avatarCategories = this.categories;
-		} else if (this.config.type.equals("Script")) {
-			MainAbility.scriptCategories = this.categories;
-		}else if(this.config.type.equals("Domain")) {
-			MainAbility.domainCategories = this.categories;
-		}
-		
-		//extracting everything from this.categories name,icon,description
-		listCategories = new ArrayList<ContentConfig>();
-		for (int i = 0; i < categories.length; i++) {
-			listCategories.add((ContentConfig)this.categories[i]);
-		}
-		
-		//extracting the names from this.categories
-		Object[] names = new Object[this.categories.length];
-		for (int index = 0; index < this.categories.length; index++) {
-			names[index] = (((ContentConfig)this.categories[index]).name);
-		}
-		
-//		llview = (ListView) this.ability.findViewById(R.id.theListView);
-//        if (llview != null) {
-//	        ArrayAdapter adapter = new CategoryListAdapter(this.ability,
-//	                R.layout.image_list, listCategories);
-//	        llview.setAdapter(adapter);
-//        }
-	}
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java
deleted file mode 100644
index 54ce4a48090960bc13514419d93e41bb8d7cf3a4..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetChannelBotModeAction.java
+++ /dev/null
@@ -1,62 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.BotModeConfig;
-import org.botlibre.sdk.config.ChannelConfig;
-import ohos.aafwk.ability.Ability;
-public class HttpGetChannelBotModeAction extends HttpUIAction {
-	ChannelConfig config;
-	BotModeConfig botMode;
-
-	public HttpGetChannelBotModeAction(Ability ability, ChannelConfig config) {
-		super(ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.botMode = MainAbility.connection.getChannelBotMode(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.botMode = botMode;
-			
-//			((ChannelBotAbility)this.ability).resetView();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java
deleted file mode 100644
index 69b856c7fcee7ce4779779739e2ebc494ba46f71..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetImageAction.java
+++ /dev/null
@@ -1,286 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.io.File;
-import java.io.FileOutputStream;
-import java.io.InputStream;
-import java.lang.ref.SoftReference;
-import java.net.URL;
-import java.util.Hashtable;
-import java.util.Map;
-
-import org.botlibre.sdk.MainAbility;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.components.Component;
-import ohos.agp.components.Image;
-import ohos.app.Context;
-import ohos.media.image.PixelMap;
-
-public class HttpGetImageAction extends HttpAction {
-    public static int MAX_HEIGHT = 1200;
-    public static int MAX_WIDTH = 600;
-    public static int MAX_FILES = 100;
-
-    public static volatile boolean downloading;
-
-    public static File cacheDir;
-    public static Map<String, SoftReference<PixelMap>> imageCache = new Hashtable<String, SoftReference<PixelMap>>();
-
-    String image;
-    PixelMap bmp;
-    Image view;
-
-
-    public static void setImage(int imageId, Component view) {
-        if (view instanceof Image) {
-//			((Image) view).setImageResource(imageId);
-        }
-    }
-
-    public static void clearFileCache(Context context) {
-        try {
-            File[] files = getFileCacheDir(context).listFiles();
-            if (files == null) {
-                return;
-            }
-            for (File file : files) {
-                if (file.isDirectory()) {
-                    File[] nested = file.listFiles();
-                    for (File nestedFile : nested) {
-                        if (!nestedFile.isDirectory()) {
-                            nestedFile.delete();
-                        }
-                    }
-                } else {
-                    file.delete();
-                }
-            }
-        } catch (Exception failed) {
-//			Log.wtf(failed.toString(), failed);
-        }
-    }
-
-    public static File getFileCacheDir(Context context) {
-        if (cacheDir == null) {
-            try {
-
-                cacheDir = context.getCacheDir();
-                if (!cacheDir.exists()) {
-                    cacheDir.mkdirs();
-                }
-            } catch (Exception failed) {
-                failed.printStackTrace();
-                return null;
-            }
-        }
-        return cacheDir;
-    }
-
-    public static File getFile(String filename, Context context) {
-        File dir = getFileCacheDir(context);
-        if (dir == null) {
-            return null;
-        }
-
-        File file = new File(dir.getAbsolutePath() + "/" + filename);
-        dir = new File(file.getParent());
-        if (!dir.exists()) {
-            dir.mkdir();
-        } else {
-            File[] files = dir.listFiles();
-            if (files.length > MAX_FILES) {
-                for (File nestedFile : files) {
-                    if (!nestedFile.isDirectory()) {
-                        nestedFile.delete();
-                    }
-                }
-            }
-        }
-        return file;
-    }
-
-    public static File getFile(String dirName, String filename, Context context) {
-        File dir = getFileCacheDir(context);
-        if (dir == null) {
-            return null;
-        }
-
-        File file = new File(dir.getAbsolutePath() + "/" + dirName + "/" + filename);
-        dir = new File(file.getParent());
-        if (!dir.exists()) {
-            dir.mkdir();
-        } else {
-            File[] files = dir.listFiles();
-            if (files.length > MAX_FILES) {
-                for (File nestedFile : files) {
-                    if (!nestedFile.isDirectory()) {
-                        nestedFile.delete();
-                    }
-                }
-            }
-        }
-        return file;
-    }
-
-    public static void fetchImage(Ability Ability, String image, Image view) {
-        if (image == null) {
-            return;
-        }
-        SoftReference<PixelMap> ref = imageCache.get(image);
-        if (ref != null) {
-            PixelMap bmp = ref.get();
-            if (bmp != null) {
-                if (view instanceof Image) {
-                    view.setPixelMap(bmp);
-                }
-                return;
-            }
-        }
-        HttpGetImageAction action = new HttpGetImageAction(Ability, image, view);
-        try {
-            action.execute().get();
-            action.postExecute();
-            if (action.getException() != null) {
-                throw action.getException();
-            }
-        } catch (Exception exception) {
-            if (MainAbility.DEBUG) {
-                exception.printStackTrace();
-            }
-            return;
-        }
-    }
-
-    public HttpGetImageAction(Ability Ability) {
-        super(Ability);
-    }
-
-    public HttpGetImageAction(Ability Ability, String image, Image view) {
-        super(Ability);
-        this.image = image;
-        this.view = view;
-    }
-
-    @Override
-    protected String doInBackground(Void... params) {
-        try {
-            URL url = MainAbility.connection.fetchImage(this.image);
-		    
-		    /*BitmapFactory.Options options = new BitmapFactory.Options();
-		    options.inJustDecodeBounds = true;
-		    long start = System.currentTimeMillis();
-		    InputStream stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream, null, options);
-		    stream.close();
-		    System.out.println("decodeStream1:" + (System.currentTimeMillis() - start));
-
-	        int height = options.outHeight;
-	        int width = options.outWidth;
-	        options.inPreferredConfig = Bitmap.Config.RGB_565;
-	        int inSampleSize = 1;
-
-	        if (height > MAX_HEIGHT) {
-	            inSampleSize = Math.round((float)height / (float)MAX_HEIGHT);
-	        }
-
-	        int expectedWidth = width / inSampleSize;
-
-	        if (expectedWidth > MAX_WIDTH) {
-	            inSampleSize = Math.round((float)width / (float)MAX_WIDTH);
-	        }
-
-		    options.inSampleSize = inSampleSize;
-		    options.inJustDecodeBounds = false;
-
-		    start = System.currentTimeMillis();
-		    stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream, null, options).recycle();
-		    stream.close();
-		    System.out.println("decodeStream2:" + (System.currentTimeMillis() - start));
-
-		    start = System.currentTimeMillis();
-		    stream = url.openConnection().getInputStream();
-		    BitmapFactory.decodeStream(stream).recycle();
-		    stream.close();
-		    System.out.println("decodeStream-full:" + (System.currentTimeMillis() - start));*/
-
-            File file = getFile(this.image, this.ability);
-            if (!file.exists()) {
-                downloading = true;
-                file.createNewFile();
-                FileOutputStream outputStream = new FileOutputStream(file);
-                InputStream stream = url.openConnection().getInputStream();
-                byte[] bytes = new byte[1024];
-                int count = 0;
-                while (count != -1) {
-                    count = stream.read(bytes, 0, 1024);
-                    if (count == -1) {
-                        break;
-                    }
-                    outputStream.write(bytes, 0, count);
-                }
-                stream.close();
-                outputStream.close();
-                downloading = false;
-            }
-
-//		    BitmapFactory.Options options = new BitmapFactory.Options();
-//		    options.inJustDecodeBounds = true;
-//		    InputStream stream = new FileInputStream(file);
-//		    BitmapFactory.decodeStream(stream, null, options);
-//		    stream.close();
-//
-//	        int height = options.outHeight;
-//	        int width = options.outWidth;
-//	        options.inPreferredConfig = Bitmap.Config.RGB_565;
-//	        int inSampleSize = 1;
-//	        if (height > MAX_HEIGHT) {
-//	            inSampleSize = Math.round((float)height / (float)MAX_HEIGHT);
-//	        }
-//	        int expectedWidth = width / inSampleSize;
-//	        if (expectedWidth > MAX_WIDTH) {
-//	            inSampleSize = Math.round((float)width / (float)MAX_WIDTH);
-//	        }
-//		    options.inSampleSize = inSampleSize;
-//		    options.inJustDecodeBounds = false;
-//
-//		    stream = new FileInputStream(file);
-//		    this.bmp = BitmapFactory.decodeStream(stream, null, options);
-//		    stream.close();
-//
-//	        imageCache.put(this.image, new SoftReference<Bitmap>(this.bmp));
-            return "";
-        } catch (Exception exception) {
-            if (MainAbility.DEBUG) {
-                exception.printStackTrace();
-            }
-        }
-        return null;
-    }
-
-    protected void postExecute() {
-        if (view instanceof Image) {
-//			((Image)view).setImageBitmap(bmp);
-        }
-//		else if (view instanceof Button) {
-////			((Button)view).setBackgroundDrawable(new BitmapDrawable(view.getResources(), bmp));
-//		}
-    }
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java
deleted file mode 100644
index 0b1eb32bf7b02b5e1fd40edd01abb83994444de7..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetUsersAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.util.List;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpGetUsersAction extends HttpUIAction {
-
-	WebMediumConfig config;
-	List<String> users;
-	
-	public HttpGetUsersAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.users = MainAbility.connection.getUsers(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		try {
-//			((WebMediumUsersAbility)this.ability).users = this.users;
-//			((WebMediumUsersAbility)this.ability).resetView();
-//		} catch (Exception error) {
-//			this.exception = error;
-//			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-//			return;
-//		}
-	}
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java
deleted file mode 100644
index fa59737fed7c834f60f88e4b4b0b9925aad5ca5a..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpGetVideoAction.java
+++ /dev/null
@@ -1,107 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import java.io.File;
-import java.io.FileOutputStream;
-import java.io.InputStream;
-import java.net.URL;
-
-import org.botlibre.sdk.MainAbility;
-
-import ohos.aafwk.ability.Ability;
-import ohos.utils.net.Uri;
-
-public class HttpGetVideoAction extends HttpGetImageAction {
-	
-	String video;
-	
-	public static Uri fetchVideo(Ability Ability, String video) {
-//		if(!MainAbility.online){
-//			 File file = getFile(GetAvatarAction.nameOfFile,video, Ability);
-//			 return Uri.getUriFromFile(file);
-//		}
-		
-		if (video == null) {
-			return null;
-		}
-		
-    	if (downloading) {
-    		return null;
-    	}
-	    File file = getFile(video, Ability);
-	    if (file.exists()) {
-	    	if (downloading) {
-	    		return null;
-	    	}
-	    	return Uri.getUriFromFile(file);
-	    }
-			HttpGetVideoAction action = new HttpGetVideoAction(Ability, video);
-			try {
-				action.execute().get();
-				if (action.getException() != null) {
-					throw action.getException();
-				}
-			} catch (Exception exception) {
-				if (MainAbility.DEBUG) {
-					exception.printStackTrace();
-				}
-			}
-		return Uri.getUriFromFile(file);
-	}
-	
-	public HttpGetVideoAction(Ability Ability, String video) {
-		super(Ability);
-		this.video = video;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-        try {
-	        URL url = MainAbility.connection.fetchImage(this.video);
-
-		    File file = getFile(this.video, this.ability);
-		    if (!file.exists()) {
-		    	downloading = true;
-		    	file.createNewFile();
-		    	FileOutputStream outputStream = new FileOutputStream(file);
-			    InputStream stream = url.openConnection().getInputStream();
-		    	byte[] bytes= new byte[1024];
-		    	int count = 0;
-	            while (count != -1) {
-	            	count = stream.read(bytes, 0, 1024);
-		            if (count == -1) {
-		            	break;
-		            }
-		            outputStream.write(bytes, 0, count);
-	            }
-	            stream.close();
-	            outputStream.close();
-		    	downloading = false;
-		    }
-	        return "";
-        } catch (Exception exception) {
-    		if (MainAbility.DEBUG) {
-    			exception.printStackTrace();
-    		}
-	    	downloading = false;
-        }
-        return null;
-	}
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java
deleted file mode 100644
index 2de192312807f618aa88b9147b9a9e89ddd7a8de..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpImportBotLogAction.java
+++ /dev/null
@@ -1,63 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.ScriptConfig;
-import org.botlibre.sdk.config.ScriptSourceConfig;
-
-import ohos.aafwk.ability.Ability;
-
-public class HttpImportBotLogAction extends HttpUIAction {
-	ScriptConfig config;
-	ScriptSourceConfig script;
-	
-	public HttpImportBotLogAction(Ability Ability, ScriptConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			//this.script = MainAbility.connection.getScriptSource(this.config);
-
-			MainAbility.connection.importBotLog(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java
deleted file mode 100644
index 74aef5d5a0035f65043618cc78f922f1f71d7c35..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpPageIssuesAction.java
+++ /dev/null
@@ -1,59 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.BrowseConfig;
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-import java.util.List;
-
-public class HttpPageIssuesAction extends HttpUIAction {
-	BrowseConfig config;
-	List<IssueConfig> issues;
-
-	public HttpPageIssuesAction(Ability Ability, BrowseConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			this.issues = MainAbility.connection.getIssues(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		MainAbility.issues = this.issues;
-		MainAbility.browseIssues = this.config;
-//        ((BrowseIssueAbility)this.ability).instances = this.issues;
-//        ((BrowseIssueAbility)this.ability).resetView();
-	}
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java
deleted file mode 100644
index 587c7257adf18e8ff6152b619796f1b5d5758fe6..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveAvatarBackgroundAction.java
+++ /dev/null
@@ -1,53 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.config.AvatarMedia;
-import ohos.aafwk.ability.Ability;
-import ohos.agp.window.dialog.CommonDialog;
-
-public class HttpSaveAvatarBackgroundAction extends HttpUIAction {
-
-	AvatarMedia config;
-	String file;
-	
-	public HttpSaveAvatarBackgroundAction(Ability Ability, String file, AvatarMedia config) {
-		super(Ability);
-		this.config = config;
-		this.file = file;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveAvatarBackground(this.file, this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	@Override
-	protected void onPreExecute() {
-		this.dialog = new CommonDialog(this.ability);
-		this.dialog.setAutoClosable(false);
-		this.dialog.setContentText("Processing...");
-		this.dialog.show();
-	}
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java
deleted file mode 100644
index 08122ddf48e99870f10fd153798c5951a92de145..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpSaveBotScriptSourceAction.java
+++ /dev/null
@@ -1,58 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2016 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ScriptSourceConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpSaveBotScriptSourceAction extends HttpUIAction {
-	
-	ScriptSourceConfig config;
-
-	public HttpSaveBotScriptSourceAction(Ability Ability, ScriptSourceConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-	
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.saveBotScriptSource(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-	
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-//		BotScriptEditorAbility didItCompile = (BotScriptEditorAbility)this.Ability;
-//		didItCompile.didCompile();
-		MainAbility.script = this.config;
-		
-		this.ability.terminateAbility();
-	}
-
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java
deleted file mode 100644
index 3cf693ce0e206042caef81d3a9caf9cf2e92f485..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpStarAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpStarAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpStarAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.star(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.instance.stars = config.stars;
-//	    ((WebMediumAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java
deleted file mode 100644
index dc358e874865654b88dd5c2c8edaf594cb7dc68e..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsDownAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpThumbsDownAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsDown(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.instance.thumbsDown++;
-//	    ((WebMediumAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java
deleted file mode 100644
index fa19590eace83bb6798d6257e8f09ddb393cfb23..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpThumbsDownPostAction.java
+++ /dev/null
@@ -1,54 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.ForumPostConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpThumbsDownPostAction extends HttpUIAction {
-	ForumPostConfig config;
-
-	public HttpThumbsDownPostAction(Ability Ability, ForumPostConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.thumbsDown(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	    MainAbility.post.thumbsDown++;
-//	    ((ForumPostAbility)this.ability).resetView();
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java
deleted file mode 100644
index 229fa929e0a4c2cd33972f85edb50cf78ba973ec..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUnsubscribeIssueAction.java
+++ /dev/null
@@ -1,52 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.IssueConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUnsubscribeIssueAction extends HttpUIAction {
-	IssueConfig config;
-
-	public HttpUnsubscribeIssueAction(Ability Ability, IssueConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		MainAbility.connection.unsubscribe(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-	}
-	
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java
deleted file mode 100644
index cafad9bad01c877f74826c37c25ac8307af9a2ad..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUpdateAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/******************************************************************************
- *
- *  Copyright 2014 Paphus Solutions Inc.
- *
- *  Licensed under the Eclipse Public License, Version 1.0 (the "License");
- *  you may not use this file except in compliance with the License.
- *  You may obtain a copy of the License at
- *
- *      http://www.eclipse.org/legal/epl-v10.html
- *
- *  Unless required by applicable law or agreed to in writing, software
- *  distributed under the License is distributed on an "AS IS" BASIS,
- *  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- *  See the License for the specific language governing permissions and
- *  limitations under the License.
- *
- ******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.WebMediumConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUpdateAction extends HttpUIAction {
-	WebMediumConfig config;
-
-	public HttpUpdateAction(Ability Ability, WebMediumConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-		this.config = MainAbility.connection.update(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		try {
-			MainAbility.instance = this.config;
-			this.ability.terminateAbility();
-		} catch (Exception error) {
-			this.exception = error;
-			MainAbility.error(this.exception.getMessage(), this.exception, this.ability);
-			return;
-		}
-	}
-
-}
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java
deleted file mode 100644
index 76cd86884ffbabae44d1f09483764a44036ee87a..0000000000000000000000000000000000000000
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/activityy/actions/HttpUserMessageAction.java
+++ /dev/null
@@ -1,60 +0,0 @@
-/******************************************************************************
-*
-*  Copyright 2017 Paphus Solutions Inc.
-*
-*  Licensed under the Eclipse Public License, Version 1.0 (the "License");
-*  you may not use this file except in compliance with the License.
-*  You may obtain a copy of the License at
-*
-*      http://www.eclipse.org/legal/epl-v10.html
-*
-*  Unless required by applicable law or agreed to in writing, software
-*  distributed under the License is distributed on an "AS IS" BASIS,
-*  WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-*  See the License for the specific language governing permissions and
-*  limitations under the License.
-*
-******************************************************************************/
-
-package org.botlibre.sdk.activityy.actions;
-
-import org.botlibre.sdk.MainAbility;
-
-import org.botlibre.sdk.config.UserMessageConfig;
-import ohos.aafwk.ability.Ability;
-
-public class HttpUserMessageAction extends HttpAction {
-
-	UserMessageConfig config;
-
-	public HttpUserMessageAction(Ability Ability, UserMessageConfig config) {
-		super(Ability);
-		this.config = config;
-	}
-
-	@Override
-	protected String doInBackground(Void... params) {
-		try {
-			MainAbility.connection.createUserMessage(this.config);
-		} catch (Exception exception) {
-			this.exception = exception;
-		}
-		return "";
-	}
-
-	@Override
-	public void onPostExecute(String xml) {
-		super.onPostExecute(xml);
-		if (this.exception != null) {
-			return;
-		}
-		/*AlertDialog dialog = new AlertDialog.Builder(Ability).create();
-		dialog.setMessage("Chatlog sent.");
-		dialog.setButton(AlertDialog.BUTTON_NEUTRAL, "OK", new DialogInterface.OnClickListener() {
-		      public void onClick(DialogInterface dialog, int which) {
-		    	  Ability.finish();
-		      }
-		});
-		dialog.show();*/
-    }
-}
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
index 275ea4125ece92822879c086888206de39df99bb..41dbaed5e671dd26bfe9b681ea0cfb8c343547ce 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/config/AvatarConfig.java
@@ -44,7 +44,13 @@ public class AvatarConfig extends WebMediumConfig {
 	public AvatarConfig(){
 		mediaConfig = new HashMap<String, AvatarMedia>();
 	}
-	
+
+	/**
+	 * chatReply
+	 *
+	 * @param chat ChatResponse
+	 * @return ChatResponse
+	 * */
 	public ChatResponse chatReply(ChatResponse chat) {
 		String emotion =  MicroConnection.getBot().mood().currentEmotionalState().name();
 		String action = MicroConnection.getBot().avatar().getAction();
@@ -117,74 +123,22 @@ public class AvatarConfig extends WebMediumConfig {
 		}
 		return chat;
 	}
-
-//	public String getDefaultAvatarMediaOne(){
-//		String name = null;
-//		for (AvatarMedia media: mediaConfig.values()) {
-//			if(!media.talking && media.hd && media.name.contains("blink") && media.poses.equals("") && media.emotions.equals("")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId+"."+array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	public String getDefaultAvatarMediaTwo(){
-//		String name = null;
-//		for (AvatarMedia media: mediaConfig.values()) {
-//			if(!media.talking && media.hd && media.name.contains("blink") && media.emotions.contains("HAPPY")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId+"."+array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	
-//	public String getDefaultAvatarMediaThree(){
-//		String name = null;
-//		for (AvatarMedia media: mediaConfig.values()) {
-//			if(!media.talking && media.hd && media.name.contains("blink") && media.emotions.contains("ANGER")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId+"."+array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	public String getDefaultAvatarMediaFour(){
-//		String name = null;
-//		for (AvatarMedia media: mediaConfig.values()) {
-//			if(!media.talking && media.hd && media.name.contains("blink") && media.emotions.equals("") && media.poses.contains("sleeping")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId+"."+array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	public String getTalkingAvatarMedia(){
-//		String name = null;
-//		for(AvatarMedia media : mediaConfig.values()){
-//			if(media.talking && media.hd && media.name.contains("talk")){
-//				String[] array = media.media.split("\\.");
-//				name = media.mediaId +"."+ array[1];
-//				type = media.type;
-//			}
-//		}
-//		return name;
-//	}
-//	
-//	public String getTypeAvatarMedia(){
-//		return type;
-//	}
-	
+    /**
+	 * credentials
+	 *
+	 * @return WebMediumConfig
+	 * */
 	public WebMediumConfig credentials() {
 		AvatarConfig config = new AvatarConfig();
 		config.id = this.id;
 		return config;
 	}
-	
+
+	/**
+	 * toXML
+	 *
+	 * @return String
+	 * */
 	public String toXML() {
 		StringWriter writer = new StringWriter();
 		writer.write("<avatar");
@@ -192,14 +146,24 @@ public class AvatarConfig extends WebMediumConfig {
 		writer.write("</avatar>");
 		return writer.toString();
 	}
-	
-	
+
+	/**
+	 * parseXML
+	 *
+	 * @param element Element
+	 * */
 	public void parseXML(Element element) {
 		super.parseXML(element);
 	}
 	
 	/**
 	 * Find any media that match the emotion, action, and pose, or the best matches.
+	 *
+	 * @param emotion String
+	 * @param action String
+	 * @param pose String
+	 * @param pose2 String
+	 * @return List<AvatarMedia>
 	 */
 	public List<AvatarMedia> getMedia(String emotion, String action, String pose, String pose2) {
 		if (emotion == null || emotion.isEmpty()) {
@@ -464,6 +428,10 @@ public class AvatarConfig extends WebMediumConfig {
 	
 	/**
 	 * Find an audio media that matches the action or pose.
+	 *
+	 * @param action String
+	 * @param pose String
+	 * @return List<AvatarMedia>
 	 */
 	public List<AvatarMedia> getAudio(String action, String pose) {
 		if (action == null) {
@@ -542,6 +510,12 @@ public class AvatarConfig extends WebMediumConfig {
 		return matches;
 	}
 
+    /**
+	 * randomMatch
+	 *
+	 * @param matches List<AvatarMedia>
+	 * @return AvatarMedia
+	 * */
 	public AvatarMedia randomMatch(List<AvatarMedia> matches) {
 		List<AvatarMedia> formatMatches = new ArrayList<AvatarMedia>();
 		String format = "mp4";
@@ -582,10 +556,20 @@ public class AvatarConfig extends WebMediumConfig {
 		}
 	}
 
+    /**
+	 * getBackground
+	 *
+	 * @return String
+	 * */
 	public String getBackground(){
 		return background;
 	}
 
+	/**
+	 * getIcon
+	 *
+	 * @return String
+	 * */
 	public String getIcon(){
 		return icon;
 	}
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
index a1b9b74dea95e217b4796f98f0bd08244835032d..e420723e22908f7393ac1454e6a2ba8a1c845ebc 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/micro/BootstrapAsync.java
@@ -1,7 +1,7 @@
 package org.botlibre.sdk.micro;
 
 import org.botlibre.sdk.MainAbility;
-import org.botlibre.sdk.activityy.actions.HttpUIAction;
+import org.botlibre.sdk.ability.actions.HttpUIAction;
 import org.botlibre.sdk.config.InstanceConfig;
 import org.botlibre.sdk.config.ScriptConfig;
 import org.botlibre.sdk.config.ScriptSourceConfig;
@@ -9,13 +9,9 @@ import org.botlibre.sdk.util.PreferencesUtils;
 import ohos.aafwk.ability.Ability;
 import ohos.data.preferences.Preferences;
 import org.botlibre.Bot;
-import org.botlibre.api.knowledge.Network;
-import org.botlibre.api.knowledge.Vertex;
 import org.botlibre.api.sense.Sense;
 import org.botlibre.knowledge.Bootstrap;
-import org.botlibre.knowledge.Primitive;
 import org.botlibre.knowledge.micro.MicroMemory;
-import org.botlibre.self.SelfCompiler;
 import org.botlibre.sense.http.Wiktionary;
 import org.botlibre.sense.text.TextEntry;
 import org.botlibre.thought.consciousness.Consciousness;
@@ -169,20 +165,6 @@ public class BootstrapAsync extends HttpUIAction {
 		return null;
 	}
 
-	/**
-	 * Load, compile, and add the state machine from the Self source code.
-	 */
-	public void loadSelf(Bot bot, String text) {
-
-		Network network = bot.memory().newMemory();
-		Vertex language = network.createVertex(bot.mind().getThought(Language.class).getPrimitive());
-		SelfCompiler compiler = SelfCompiler.getCompiler();
-		Vertex stateMachine = compiler.parseStateMachine(text, false, network);
-		SelfCompiler.getCompiler().pin(stateMachine);
-		language.addRelationship(Primitive.STATE, stateMachine);
-		network.save();
-	}
-	
 	@Override
 	protected void onPostExecute(String result) {
 		super.onPostExecute(result);
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
index 4a4515556ebf6415ad794faaf9beffc7a0c8292a..cd4461bffd1f793e3d7d733240ae875d93ef4def 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/micro/MicroConnection.java
@@ -18,9 +18,6 @@
 
 package org.botlibre.sdk.micro;
 
-import java.io.File;
-import java.io.IOException;
-import java.io.InputStream;
 import java.net.URL;
 import java.util.HashMap;
 import java.util.Map;
@@ -72,20 +69,37 @@ public class MicroConnection extends SDKConnection implements TextListener {
 	/**
 	 * Create a micro/offline SDK connection.
 	 * Use the credentials to enable online support.
+	 *
+	 * @param credentials Credentials
 	 */
 	public MicroConnection(Credentials credentials) {
 		this.credentials = credentials;
 		this.url = credentials.url;
 	}
 
+    /**
+	 * addBot
+	 *
+	 * @param bot Bot
+	 * @param id String
+	 * */
 	public void addBot(String id, Bot bot) {
 		activeBots.put(id, bot);
 	}
-
+	/**
+	 * getBot
+	 *
+	 * @param id String
+	 * @return Bot
+	 * */
 	public Bot getBot(String id) {
 		return activeBots.get(id);
 	}
-
+	/**
+	 * getBot
+	 *
+	 * @return Bot
+	 * */
 	public static Bot getBot() {
 		return bot;
 	}
@@ -93,9 +107,12 @@ public class MicroConnection extends SDKConnection implements TextListener {
 	/**
 	 * Process the bot chat message and return the bot's response.
 	 * The ChatConfig should contain the conversation id if part of a conversation.
-	 * If a new conversation the conversation id is returned in the response. 
+	 * If a new conversation the conversation id is returned in the response.
+	 *
+	 * @param config ChatConfig
+	 * @return ChatResponse
 	 */
-	public synchronized ChatResponse chat(ChatConfig config) {
+	public  ChatResponse chat(ChatConfig config) {
 		if (config.instance == null) {
 			config.instance = "default";
 		}
@@ -112,7 +129,9 @@ public class MicroConnection extends SDKConnection implements TextListener {
 				}
 				i++;
 			}
-		} catch (Exception e) {}
+		} catch (Exception e) {
+
+		}
 
 		if (bot == null) {
 			this.exception = new SDKException("Bot doesn't exists!");
@@ -154,6 +173,9 @@ public class MicroConnection extends SDKConnection implements TextListener {
 	
 	/**
 	 * Fetch the local object.
+	 *
+	 * @param config config
+	 * @return WebMediumConfig
 	 */
 	public <T extends WebMediumConfig> T fetch(T config) {
 		this.config = config;
@@ -169,6 +191,9 @@ public class MicroConnection extends SDKConnection implements TextListener {
 	
 	/**
 	 * Return the bot's voice configuration.
+	 *
+	 * @param config InstanceConfig
+	 * @return VoiceConfig
 	 */
 	public VoiceConfig getVoice(InstanceConfig config) {
 		VoiceConfig voice = new VoiceConfig();
@@ -176,13 +201,25 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		voice.language = "en";
 		return voice;
 	}
-	
+
+	/**
+	 * sendMessage
+	 *
+	 * @param message TextOutput
+	 * */
 	public synchronized void sendMessage(TextOutput message) {
 		this.message = message;
 		notifyAll();
 	}
-	
-	public synchronized Bot loadBot(String name, int id) {
+
+	/**
+	 * loadBot
+	 *
+	 * @param id int
+	 * @param name String
+	 * @return Bot
+	 * */
+	public  Bot loadBot(String name, int id) {
 		boolean exists = MicroMemory.checkExists();
 		Bot.CONFIG_FILE = "config.xml";
 		Bot bot = Bot.createInstance(Bot.CONFIG_FILE, name, true);
@@ -213,24 +250,34 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		}
 		return bot;
 	}
-	
-	public void loadAIMLScript(Language lang,InputStream source){
-		lang.loadAIMLFile(source, config.id, false, false, true,"",10000000);
-	}
-	
+
+	/**
+	 * loadResScript
+	 *
+	 * @param bot Bot
+	 * @param fileName String
+	 * */
 	public void loadResScript(Bot bot, String fileName) {
 		URL url = getClass().getResource(fileName);
 		bot.awareness().getSense(TextEntry.class).loadChatFile(url, "Response List", "", false, true);
 	}
 
-	public void loadResScript(Bot bot, File file) {
-		bot.awareness().getSense(TextEntry.class).loadChatFile(file, "Response List", "", false, true);
-	}
-	
+	/**
+	 * loadSelfScript
+	 *
+	 * @param bot Bot
+	 * @param fileName String
+	 * */
 	public void loadSelfScript(Bot bot, String fileName) {
 		loadSelfScript(bot, getClass().getResource(fileName));
 	}
 
+	/**
+	 * loadSelfScript
+	 *
+	 * @param bot Bot
+	 * @param url URL
+	 * */
 	public void loadSelfScript(Bot bot, URL url) {
 		Network network = bot.memory().getShortTermMemory();
 		Vertex language = network.createVertex(new Primitive(Language.class.getName()));
@@ -240,20 +287,11 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		SelfCompiler.getCompiler().pin(stateMachine);
 	}
 
-	public void loadSelfScript(Bot bot, File file) {
-		Network network = bot.memory().getShortTermMemory();
-		Vertex language = network.createVertex(new Primitive(Language.class.getName()));
-		SelfCompiler compiler = SelfCompiler.getCompiler();
-		Vertex stateMachine = compiler.parseStateMachine(file, "", false, network);
-		language.addRelationship(Primitive.STATE, stateMachine);
-		SelfCompiler.getCompiler().pin(stateMachine);
-	}
-	
-	public void renameMemory(Bot bot, String name) {
-		bot.memory().getShortTermMemory().createVertex(Primitive.SELF).addRelationship(Primitive.NAME, bot.memory().getShortTermMemory().createVertex(name));
-		
-	}
-	
+	/**
+	 * reInitialize
+	 *
+	 * @param bot Bot
+	 * */
 	public Vertex reInitialize(Bot bot) {
 		Network memory = bot.memory().newMemory();
 		Vertex user = memory.createSpeaker("Admin");
@@ -261,15 +299,4 @@ public class MicroConnection extends SDKConnection implements TextListener {
 		memory.save();
 		return user;
 	}
-	
-	//copy files from jar file (using input stream to internal storage).
-	public static void copyStream(InputStream input) throws IOException {
-//		FileOutputStream output = MainAbility.current.openFileOutput(MicroMemory.storageFileName,
-//				Ability.MODE_PRIVATE);
-//		byte[] buffer = new byte[1024]; // Adjust if you want
-//		int bytesRead;
-//		while ((bytesRead = input.read(buffer)) != -1) {
-//			output.write(buffer, 0, bytesRead);
-//		}
-	}
 }
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
index 66d558f2128ec4a3b619ba4abaaa29680b0d1c29..8f99e2936c02291eeaa0a631307201d7ae73faa8 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/provider/ChatListProvicer.java
@@ -1,10 +1,7 @@
 package org.botlibre.sdk.provider;
 
-import org.botlibre.sdk.MainAbility;
 import org.botlibre.sdk.ResourceTable;
-import org.botlibre.sdk.SDKConnection;
-import org.botlibre.sdk.activityy.ChatAbility;
-import org.botlibre.sdk.activityy.actions.HttpGetImageAction;
+import org.botlibre.sdk.ability.ChatAbility;
 import org.botlibre.sdk.config.ChatConfig;
 import org.botlibre.sdk.config.ChatResponse;
 import ohos.aafwk.ability.Ability;
@@ -53,24 +50,11 @@ public class ChatListProvicer extends BaseItemProvider {
         if (message instanceof ChatConfig) {
             ChatConfig config = (ChatConfig) message;
             messageView.setText(config.message);
-            if (MainAbility.user != null && MainAbility.user.avatar != null) {
-                if (MainAbility.online) {
-                    HttpGetImageAction.fetchImage(slice, MainAbility.user.avatar, userView);
-                } else {
-                    HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, userView);
-                }
-            } else {
-                HttpGetImageAction.fetchImage(slice, SDKConnection.defaultUserImage(), userView);
-            }
+
         } else if (message instanceof ChatResponse) {
             ChatResponse config = (ChatResponse) message;
             messageView.setText(Utils.stripTags(config.message));
             String avatar = ((ChatAbility) this.slice).getAvatarIcon(config);
-            if (MainAbility.online) {
-                HttpGetImageAction.fetchImage(slice, avatar, userView);
-            } else {
-                HttpGetImageAction.setImage(MainAbility.offlineSelectedImage, userView);
-            }
         }
 
         return cpt;
diff --git a/SantaBot/entry/src/main/java/org/botlibre/sdk/util/Utils.java b/SantaBot/entry/src/main/java/org/botlibre/sdk/util/Utils.java
index e2667554458cf4b39b09db6f45618ae95b08168b..7faf833f8a9bc32910769222b6409f2e9b47538d 100644
--- a/SantaBot/entry/src/main/java/org/botlibre/sdk/util/Utils.java
+++ b/SantaBot/entry/src/main/java/org/botlibre/sdk/util/Utils.java
@@ -47,6 +47,9 @@ public class Utils {
 	/**
 	 * Replace links with HTML links.
 	 * Includes http, www, images, video, audio, email address.
+	 *
+	 * @param text String
+	 * @return String
 	 */
 	public static String linkHTML(String text) {
 		if (text == null || text.length() == 0) {
@@ -106,6 +109,9 @@ public class Utils {
 
 	/**
 	 * Replace reserved HTML character with their HTML escape codes.
+	 *
+	 * @param html String
+	 * @return String
 	 */
 	public static String escapeHTML(String html) {
 		return html.replace("&", "&amp;")
@@ -118,6 +124,9 @@ public class Utils {
 
 	/**
 	 * Strip the HTML tags from the text.
+	 *
+	 * @param html String
+	 * @return String
 	 */
 	public static String stripTags(String html) {
 		if (html == null) {
@@ -165,187 +174,11 @@ public class Utils {
 	}
 
 	/**
-	 * Format the text that may be HTML, or may be text, or markup, or a mix.
-	 */
-	public static String formatHTMLOutput(String text) {
-		if (text == null) {
-			return "";
-		}
-		int index = text.indexOf('<');
-		int index2 = text.indexOf('>');
-		boolean isHTML = (index != -1) && (index2 > index);
-		boolean isMixed = isHTML && text.contains("[code]");
-		if (isHTML && !isMixed) {
-			return text;
-		}
-		if (!isMixed && ((index != -1) || (index2 != -1))) {
-			text = text.replace("<", "&lt;");
-			text = text.replace(">", "&gt;");
-		}
-		TextStream stream = new TextStream(text);
-		StringWriter writer = new StringWriter();
-		boolean bullet = false;
-		boolean nbullet = false;
-		while (!stream.atEnd()) {
-			String line = stream.nextLine();
-			if (!isMixed && (line.contains("http://") || line.contains("https://"))) {
-				line = Utils.linkHTML(line);
-			}
-			TextStream lineStream = new TextStream(line);
-			boolean firstWord = true;
-			boolean span = false;
-			boolean cr = true;
-			while (!lineStream.atEnd()) {
-				while (!isMixed && firstWord && lineStream.peek() == ' ') {
-					lineStream.next();
-					writer.write("&nbsp;");
-				}
-				String whitespace = lineStream.nextWhitespace();
-				writer.write(whitespace);
-				if (lineStream.atEnd()) {
-					break;
-				}
-				String word = lineStream.nextWord();
-				if (!isMixed && nbullet && firstWord && !word.equals("#")) {
-					writer.write("</ol>\n");
-					nbullet = false;
-				} else if (!isMixed && bullet && firstWord && !word.equals("*")) {
-					writer.write("</ul>\n");
-					bullet = false;
-				}
-				if (firstWord && word.equals("[")) {
-					String peek = lineStream.peekWord();
-					if ("code".equals(peek)) {
-						lineStream.nextWord();
-						String next = lineStream.nextWord();
-						String lang = "javascript";
-						int lines = 20;
-						if ("lang".equals(next)) {
-							lineStream.skip();
-							lang = lineStream.nextWord();
-							if ("\"".equals(lang)) {
-								lang = lineStream.nextWord();
-								lineStream.skip();
-							}
-							next = lineStream.nextWord();
-						}
-						if ("lines".equals(next)) {
-							lineStream.skip();
-							String value = lineStream.nextWord();
-							if ("\"".equals(value)) {
-								value = lineStream.nextWord();
-								lineStream.skip();
-							}
-							lineStream.skip();
-							try {
-								lines = Integer.valueOf(value);
-							} catch (NumberFormatException ignore) {}
-						}
-						String id = "code" + stream.getPosition();
-						writer.write("<div style=\"width:100%;height:" + lines * 14 + "px;max-width:none\" id=\"" + id + "\">");
-						String code = lineStream.upToAll("[code]");
-						if (code.indexOf('<') != -1) {
-							code = code.replace("<", "&lt;");
-						}
-						if (code.indexOf('>') != -1) {
-							code = code.replace(">", "&gt;");
-						}
-						writer.write(code);
-						while (lineStream.atEnd() && !stream.atEnd()) {
-							line = stream.nextLine();
-							lineStream = new TextStream(line);
-							while (lineStream.peek() == ':') {
-								lineStream.next();
-								writer.write("&nbsp;&nbsp;&nbsp;&nbsp;");								
-							}
-							code = lineStream.upToAll("[code]");
-							if (code.indexOf('<') != -1) {
-								code = code.replace("<", "&lt;");
-							}
-							if (code.indexOf('>') != -1) {
-								code = code.replace(">", "&gt;");
-							}
-							writer.write(code);
-						}
-						lineStream.skip("[code]".length());
-						writer.write("</div>\n");
-
-						writer.write("<script>\n");
-						writer.write("var " + id + " = ace.edit('" + id + "');\n");
-						writer.write(id + ".getSession().setMode('ace/mode/" + lang + "');\n");
-						writer.write(id + ".setReadOnly(true);\n");
-						writer.write("</script>\n");
-					} else {
-						writer.write(word);
-					}
-				} else if (!isMixed && firstWord && word.equals("=")) {
-					int count = 2;
-					String token = word;
-					while (!lineStream.atEnd() && lineStream.peek() == '=') {
-						lineStream.skip();
-						count++;
-						token = token + "=";
-					}
-					String header = lineStream.upToAll(token);
-					if (lineStream.atEnd()) {
-						writer.write(token);
-						writer.write(header);
-					} else {
-						lineStream.skip(token.length());
-						writer.write("<h");
-						writer.write(String.valueOf(count));
-						writer.write(">");
-						writer.write(header);
-						writer.write("</h");
-						writer.write(String.valueOf(count));
-						writer.write(">");
-						cr = false;
-					}
-				} else if (!isMixed && firstWord && word.equals(":")) {
-					span = true;
-					int indent = 1;
-					while (!lineStream.atEnd() && lineStream.peek() == ':') {
-						lineStream.skip();				
-						indent++;
-					}
-					writer.write("<span style=\"display:inline-block;text-indent:");
-					writer.write(String.valueOf(indent * 20));
-					writer.write("px;\">");	
-				} else if (!isMixed && firstWord && word.equals("*")) {
-					if (!bullet) {
-						writer.write("<ul>");
-						bullet = true;
-					}
-					writer.write("<li>");
-					cr = false;
-				} else if (!isMixed && firstWord && word.equals("#")) {
-					if (!nbullet) {
-						writer.write("<ol>");
-						nbullet = true;
-					}
-					writer.write("<li>");
-					cr = false;
-				} else {
-					writer.write(word);
-				}
-				firstWord = false;
-			}
-			if (!isMixed && span) {
-				writer.write("</span>");
-			}
-			if (!isMixed && cr) { 
-				writer.write("<br/>\n");
-			}
-		}
-		if (!isMixed && bullet) {
-			writer.write("</ul>");
-		}
-		if (!isMixed && nbullet) {
-			writer.write("</ol>");
-		}
-		return writer.toString();
-	}
-	
+	 * displayTimestamp
+	 *
+	 * @param date Date
+	 * @return String
+	 * */
 	public static String displayTimestamp(Date date) {
 		if (date == null) {
 			return "";
@@ -379,7 +212,13 @@ public class Utils {
 		
 		return writer.toString();
 	}
-	
+
+	/**
+	 * displayTime
+	 *
+	 * @param date Date
+	 * @return String
+	 * */
 	public static String displayTime(Date date) {
 		if (date == null) {
 			return "";
@@ -401,7 +240,13 @@ public class Utils {
 		
 		return writer.toString();
 	}
-	
+
+	/**
+	 * displayDate
+	 *
+	 * @param date Date
+	 * @return String
+	 * */
 	public static String displayDate(Date date) {
 		if (date == null) {
 			return "";
@@ -431,6 +276,9 @@ public class Utils {
 	
 	/**
 	 * Capitalize the first character of the string.
+	 *
+	 * @param text String
+	 * @return String
 	 */
 	public static String capitalize(String text) {
 		if (text.length() == 0) {
@@ -453,65 +301,4 @@ public class Utils {
 		}
 		return list.get(random().nextInt(list.size()));
 	}
-	/**
-	 * Get the contents of the stream to a .self file and parse it.
-	 */
-	public static String loadTextFile(InputStream stream, String encoding, int maxSize, boolean finish) {
-		if (encoding.trim().isEmpty()) {
-			encoding = "UTF-8";
-		}
-
-	    // FEFF because this is the Unicode char represented by the UTF-8 byte order mark (EF BB BF).
-	    String UTF8_BOM = "\uFEFF";
-	    
-		StringWriter writer = new StringWriter();
-		InputStreamReader reader = null;
-		try {
-			reader = new InputStreamReader(stream, encoding);
-			int size = 0;
-			int next = reader.read();
-			boolean first = true;
-			while (next >= 0) {
-				if (first && next == UTF8_BOM.charAt(0)) {
-					// skip
-				} else {
-					writer.write(next);
-				}
-				next = reader.read();
-				if (size > maxSize) {
-					throw new BotException("File size limit exceeded: " + size + " > " + maxSize + " token: " + next);
-				}
-				size++;
-			}
-		} catch (IOException exception) {
-			throw new BotException("IO Error: " + exception.getMessage(), exception);
-		} finally {
-			if (reader != null && finish) {
-				try {
-					reader.close();
-				} catch (IOException ignore) {}
-			}
-			if (stream != null && finish) {
-				try {
-					stream.close();
-				} catch (IOException ignore) {}
-			}
-		}
-		return writer.toString();
-	}
-	
-	public static <T> T random(Collection<T> collection) {
-		if ((collection == null) || collection.isEmpty()) {
-			return null;
-		}
-		int value = random().nextInt(collection.size());
-		int index = 0;
-		for (T element : collection) {
-			if (index == value) {
-				return element;				
-			}
-			index++;
-		}
-		return null;
-	}
 }
\ No newline at end of file
diff --git a/SantaBot/entry/src/main/resources/base/layout/activity_chat.xml b/SantaBot/entry/src/main/resources/base/layout/ability_chat.xml
similarity index 99%
rename from SantaBot/entry/src/main/resources/base/layout/activity_chat.xml
rename to SantaBot/entry/src/main/resources/base/layout/ability_chat.xml
index c62ff63acfe676b3fae0889d109695c4f836bcff..a95efef03611e17b5b588986536c37ef20590afe 100644
--- a/SantaBot/entry/src/main/resources/base/layout/activity_chat.xml
+++ b/SantaBot/entry/src/main/resources/base/layout/ability_chat.xml
@@ -1,7 +1,7 @@
 <?xml version="1.0" encoding="utf-8"?>
 <DirectionalLayout
     xmlns:ohos="http://schemas.huawei.com/res/ohos"
-    ohos:id="$+id:activityChat"
+    ohos:id="$+id:abilityChat"
     ohos:height="match_parent"
     ohos:width="match_parent"
     ohos:orientation="vertical"
diff --git a/local.properties b/local.properties
deleted file mode 100644
index f2322a9d2c07c0ad29ebc68226fc226f18ec8f78..0000000000000000000000000000000000000000
--- a/local.properties
+++ /dev/null
@@ -1,14 +0,0 @@
-## This file is automatically generated by DevEco Studio.
-# Do not modify this file -- YOUR CHANGES WILL BE ERASED!
-#
-# This file must *NOT* be checked into Version Control Systems,
-# as it contains information specific to your local configuration.
-#
-# Location of the SDK. This is only used by Gradle.
-# For customization when using a Version Control System, please read the
-# header note.
-#Thu Jun 17 18:18:11 CST 2021
-native.dir=D\:\\harmony\\sdk\\native\\2.1.1.20
-nodejs.dir=D\:\\harmony\\DevEco Studio 2.1.0.301\\tools\\nodejs
-npm.dir=D\:\\harmony\\DevEco Studio 2.1.0.301\\tools\\nodejs
-hwsdk.dir=D\:\\harmony\\sdk